实例介绍
【实例简介】
最新官方完整包,1.3.2稳定版 Spring.Core 库是框架的基础, 提供依赖注入功能。Spring NET中大多数类库依赖或扩展了Spring.Core的功能。IObjectFactory接口提供了一个简单而优雅的工厂模式,移除了对单例和一些服务定位stub的必要。允许你将真正的程序逻辑与配置解耦。作为对IObjectFactory 的扩展,IApplicationContext接口也在Spring.Core库中, Spring DOTNET 是一个关注于.NET企业应用开发的应用程序框架。它能够提供很多方面的功能,例如控制反转(Inversion of Control,英文缩写为IoC)、依赖注入(Dependency Injection,英文缩写DI)、面向方面编程(AOP)、数据访问抽象, 以及ASP DOTNET集成等。基于java的spring框架的核心概念和价值已被应用到.NET。Spring DOTNET 1.0 包含一个完全功能的依赖注入容器和AOP库。后续的发布将包含对ASP DOTNET、Remoting和数据访问的支持。
【实例截图】
【核心代码】
4744302543288978128.zip
└── Spring.NET
├── bin
│ └── net
│ ├── 1.1
│ │ ├── debug
│ │ │ ├── Common.Logging.dll
│ │ │ ├── Spring.Aop.dll
│ │ │ ├── Spring.Aop.pdb
│ │ │ ├── Spring.Aop.xml
│ │ │ ├── Spring.Core.dll
│ │ │ ├── Spring.Core.pdb
│ │ │ ├── Spring.Core.xml
│ │ │ ├── Spring.Data.dll
│ │ │ ├── Spring.Data.NHibernate12.dll
│ │ │ ├── Spring.Data.NHibernate12.pdb
│ │ │ ├── Spring.Data.NHibernate12.xml
│ │ │ ├── Spring.Data.pdb
│ │ │ ├── Spring.Data.xml
│ │ │ ├── Spring.Services.dll
│ │ │ ├── Spring.Services.pdb
│ │ │ ├── Spring.Services.xml
│ │ │ ├── Spring.Testing.NUnit.dll
│ │ │ ├── Spring.Testing.NUnit.pdb
│ │ │ ├── Spring.Testing.NUnit.xml
│ │ │ ├── Spring.Web.dll
│ │ │ ├── Spring.Web.pdb
│ │ │ └── Spring.Web.xml
│ │ └── release
│ │ ├── Common.Logging.dll
│ │ ├── Spring.Aop.dll
│ │ ├── Spring.Aop.pdb
│ │ ├── Spring.Aop.xml
│ │ ├── Spring.Core.dll
│ │ ├── Spring.Core.pdb
│ │ ├── Spring.Core.xml
│ │ ├── Spring.Data.dll
│ │ ├── Spring.Data.NHibernate12.dll
│ │ ├── Spring.Data.NHibernate12.pdb
│ │ ├── Spring.Data.NHibernate12.xml
│ │ ├── Spring.Data.pdb
│ │ ├── Spring.Data.xml
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ ├── Spring.Services.xml
│ │ ├── Spring.Testing.NUnit.dll
│ │ ├── Spring.Testing.NUnit.pdb
│ │ ├── Spring.Testing.NUnit.xml
│ │ ├── Spring.Web.dll
│ │ ├── Spring.Web.pdb
│ │ └── Spring.Web.xml
│ ├── 2.0
│ │ ├── debug
│ │ │ ├── Common.Logging.dll
│ │ │ ├── Spring.Aop.dll
│ │ │ ├── Spring.Aop.pdb
│ │ │ ├── Spring.Aop.xml
│ │ │ ├── Spring.Core.dll
│ │ │ ├── Spring.Core.pdb
│ │ │ ├── Spring.Core.xml
│ │ │ ├── Spring.Data.dll
│ │ │ ├── Spring.Data.NHibernate12.dll
│ │ │ ├── Spring.Data.NHibernate12.pdb
│ │ │ ├── Spring.Data.NHibernate12.xml
│ │ │ ├── Spring.Data.NHibernate20.dll
│ │ │ ├── Spring.Data.NHibernate20.pdb
│ │ │ ├── Spring.Data.NHibernate20.xml
│ │ │ ├── Spring.Data.NHibernate21.dll
│ │ │ ├── Spring.Data.NHibernate21.pdb
│ │ │ ├── Spring.Data.NHibernate21.xml
│ │ │ ├── Spring.Data.pdb
│ │ │ ├── Spring.Data.xml
│ │ │ ├── Spring.Messaging.dll
│ │ │ ├── Spring.Messaging.Ems.dll
│ │ │ ├── Spring.Messaging.Ems.pdb
│ │ │ ├── Spring.Messaging.Ems.xml
│ │ │ ├── Spring.Messaging.Nms.dll
│ │ │ ├── Spring.Messaging.Nms.pdb
│ │ │ ├── Spring.Messaging.Nms.xml
│ │ │ ├── Spring.Messaging.pdb
│ │ │ ├── Spring.Messaging.xml
│ │ │ ├── Spring.Scheduling.Quartz.dll
│ │ │ ├── Spring.Scheduling.Quartz.pdb
│ │ │ ├── Spring.Scheduling.Quartz.xml
│ │ │ ├── Spring.Services.dll
│ │ │ ├── Spring.Services.pdb
│ │ │ ├── Spring.Services.xml
│ │ │ ├── Spring.Template.Velocity.dll
│ │ │ ├── Spring.Template.Velocity.pdb
│ │ │ ├── Spring.Template.Velocity.xml
│ │ │ ├── Spring.Testing.Microsoft.dll
│ │ │ ├── Spring.Testing.Microsoft.pdb
│ │ │ ├── Spring.Testing.Microsoft.xml
│ │ │ ├── Spring.Testing.NUnit.dll
│ │ │ ├── Spring.Testing.NUnit.pdb
│ │ │ ├── Spring.Testing.NUnit.xml
│ │ │ ├── Spring.Web.dll
│ │ │ ├── Spring.Web.Extensions.dll
│ │ │ ├── Spring.Web.Extensions.pdb
│ │ │ ├── Spring.Web.Extensions.xml
│ │ │ ├── Spring.Web.pdb
│ │ │ └── Spring.Web.xml
│ │ └── release
│ │ ├── Common.Logging.dll
│ │ ├── Spring.Aop.dll
│ │ ├── Spring.Aop.pdb
│ │ ├── Spring.Aop.xml
│ │ ├── Spring.Core.dll
│ │ ├── Spring.Core.pdb
│ │ ├── Spring.Core.xml
│ │ ├── Spring.Data.dll
│ │ ├── Spring.Data.NHibernate12.dll
│ │ ├── Spring.Data.NHibernate12.pdb
│ │ ├── Spring.Data.NHibernate12.xml
│ │ ├── Spring.Data.NHibernate20.dll
│ │ ├── Spring.Data.NHibernate20.pdb
│ │ ├── Spring.Data.NHibernate20.xml
│ │ ├── Spring.Data.NHibernate21.dll
│ │ ├── Spring.Data.NHibernate21.pdb
│ │ ├── Spring.Data.NHibernate21.xml
│ │ ├── Spring.Data.pdb
│ │ ├── Spring.Data.xml
│ │ ├── Spring.Messaging.dll
│ │ ├── Spring.Messaging.Ems.dll
│ │ ├── Spring.Messaging.Ems.pdb
│ │ ├── Spring.Messaging.Ems.xml
│ │ ├── Spring.Messaging.Nms.dll
│ │ ├── Spring.Messaging.Nms.pdb
│ │ ├── Spring.Messaging.Nms.xml
│ │ ├── Spring.Messaging.pdb
│ │ ├── Spring.Messaging.xml
│ │ ├── Spring.Scheduling.Quartz.dll
│ │ ├── Spring.Scheduling.Quartz.pdb
│ │ ├── Spring.Scheduling.Quartz.xml
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ ├── Spring.Services.xml
│ │ ├── Spring.Template.Velocity.dll
│ │ ├── Spring.Template.Velocity.pdb
│ │ ├── Spring.Template.Velocity.xml
│ │ ├── Spring.Testing.Microsoft.dll
│ │ ├── Spring.Testing.Microsoft.pdb
│ │ ├── Spring.Testing.Microsoft.xml
│ │ ├── Spring.Testing.NUnit.dll
│ │ ├── Spring.Testing.NUnit.pdb
│ │ ├── Spring.Testing.NUnit.xml
│ │ ├── Spring.Web.dll
│ │ ├── Spring.Web.Extensions.dll
│ │ ├── Spring.Web.Extensions.pdb
│ │ ├── Spring.Web.Extensions.xml
│ │ ├── Spring.Web.pdb
│ │ └── Spring.Web.xml
│ ├── 3.0
│ │ ├── debug
│ │ │ ├── readme-net-3.0.txt
│ │ │ ├── Spring.Services.dll
│ │ │ ├── Spring.Services.pdb
│ │ │ └── Spring.Services.xml
│ │ └── release
│ │ ├── readme-net-3.0.txt
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ └── Spring.Services.xml
│ ├── 3.5
│ │ ├── debug
│ │ │ ├── readme-net-3.5.txt
│ │ │ ├── Spring.Data.NHibernate30.dll
│ │ │ ├── Spring.Data.NHibernate30.pdb
│ │ │ ├── Spring.Data.NHibernate30.xml
│ │ │ ├── Spring.Data.NHibernate31.dll
│ │ │ ├── Spring.Data.NHibernate31.pdb
│ │ │ ├── Spring.Data.NHibernate31.xml
│ │ │ ├── Spring.Data.NHibernate32.dll
│ │ │ ├── Spring.Data.NHibernate32.pdb
│ │ │ ├── Spring.Data.NHibernate32.xml
│ │ │ ├── Spring.Scheduling.Quartz.dll
│ │ │ ├── Spring.Scheduling.Quartz.pdb
│ │ │ ├── Spring.Scheduling.Quartz.xml
│ │ │ ├── Spring.Services.dll
│ │ │ ├── Spring.Services.pdb
│ │ │ ├── Spring.Services.xml
│ │ │ ├── Spring.Web.Extensions.dll
│ │ │ ├── Spring.Web.Extensions.pdb
│ │ │ ├── Spring.Web.Extensions.xml
│ │ │ ├── Spring.Web.Mvc.dll
│ │ │ ├── Spring.Web.Mvc.pdb
│ │ │ └── Spring.Web.Mvc.xml
│ │ └── release
│ │ ├── readme-net-3.5.txt
│ │ ├── Spring.Data.NHibernate30.dll
│ │ ├── Spring.Data.NHibernate30.pdb
│ │ ├── Spring.Data.NHibernate30.xml
│ │ ├── Spring.Data.NHibernate31.dll
│ │ ├── Spring.Data.NHibernate31.pdb
│ │ ├── Spring.Data.NHibernate31.xml
│ │ ├── Spring.Data.NHibernate32.dll
│ │ ├── Spring.Data.NHibernate32.pdb
│ │ ├── Spring.Data.NHibernate32.xml
│ │ ├── Spring.Scheduling.Quartz.dll
│ │ ├── Spring.Scheduling.Quartz.pdb
│ │ ├── Spring.Scheduling.Quartz.xml
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ ├── Spring.Services.xml
│ │ ├── Spring.Web.Extensions.dll
│ │ ├── Spring.Web.Extensions.pdb
│ │ ├── Spring.Web.Extensions.xml
│ │ ├── Spring.Web.Mvc.dll
│ │ ├── Spring.Web.Mvc.pdb
│ │ └── Spring.Web.Mvc.xml
│ └── 4.0
│ ├── debug
│ │ ├── Common.Logging.dll
│ │ ├── Spring.Aop.dll
│ │ ├── Spring.Aop.pdb
│ │ ├── Spring.Aop.xml
│ │ ├── Spring.Core.dll
│ │ ├── Spring.Core.pdb
│ │ ├── Spring.Core.xml
│ │ ├── Spring.Data.dll
│ │ ├── Spring.Data.NHibernate20.dll
│ │ ├── Spring.Data.NHibernate20.pdb
│ │ ├── Spring.Data.NHibernate20.xml
│ │ ├── Spring.Data.NHibernate21.dll
│ │ ├── Spring.Data.NHibernate21.pdb
│ │ ├── Spring.Data.NHibernate21.xml
│ │ ├── Spring.Data.NHibernate30.dll
│ │ ├── Spring.Data.NHibernate30.pdb
│ │ ├── Spring.Data.NHibernate30.xml
│ │ ├── Spring.Data.NHibernate31.dll
│ │ ├── Spring.Data.NHibernate31.pdb
│ │ ├── Spring.Data.NHibernate31.xml
│ │ ├── Spring.Data.NHibernate32.dll
│ │ ├── Spring.Data.NHibernate32.pdb
│ │ ├── Spring.Data.NHibernate32.xml
│ │ ├── Spring.Data.pdb
│ │ ├── Spring.Data.xml
│ │ ├── Spring.Messaging.dll
│ │ ├── Spring.Messaging.Ems.dll
│ │ ├── Spring.Messaging.Ems.pdb
│ │ ├── Spring.Messaging.Ems.xml
│ │ ├── Spring.Messaging.Nms.dll
│ │ ├── Spring.Messaging.Nms.pdb
│ │ ├── Spring.Messaging.Nms.xml
│ │ ├── Spring.Messaging.pdb
│ │ ├── Spring.Messaging.xml
│ │ ├── Spring.Scheduling.Quartz.dll
│ │ ├── Spring.Scheduling.Quartz.pdb
│ │ ├── Spring.Scheduling.Quartz.xml
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ ├── Spring.Services.xml
│ │ ├── Spring.Template.Velocity.dll
│ │ ├── Spring.Template.Velocity.pdb
│ │ ├── Spring.Template.Velocity.xml
│ │ ├── Spring.Testing.Microsoft.dll
│ │ ├── Spring.Testing.Microsoft.pdb
│ │ ├── Spring.Testing.Microsoft.xml
│ │ ├── Spring.Testing.NUnit.dll
│ │ ├── Spring.Testing.NUnit.pdb
│ │ ├── Spring.Testing.NUnit.xml
│ │ ├── Spring.Web.dll
│ │ ├── Spring.Web.Extensions.dll
│ │ ├── Spring.Web.Extensions.pdb
│ │ ├── Spring.Web.Extensions.xml
│ │ ├── Spring.Web.Mvc3.dll
│ │ ├── Spring.Web.Mvc3.pdb
│ │ ├── Spring.Web.Mvc3.xml
│ │ ├── Spring.Web.Mvc.dll
│ │ ├── Spring.Web.Mvc.pdb
│ │ ├── Spring.Web.Mvc.xml
│ │ ├── Spring.Web.pdb
│ │ └── Spring.Web.xml
│ └── release
│ ├── Common.Logging.dll
│ ├── Spring.Aop.dll
│ ├── Spring.Aop.pdb
│ ├── Spring.Aop.xml
│ ├── Spring.Core.dll
│ ├── Spring.Core.pdb
│ ├── Spring.Core.xml
│ ├── Spring.Data.dll
│ ├── Spring.Data.NHibernate20.dll
│ ├── Spring.Data.NHibernate20.pdb
│ ├── Spring.Data.NHibernate20.xml
│ ├── Spring.Data.NHibernate21.dll
│ ├── Spring.Data.NHibernate21.pdb
│ ├── Spring.Data.NHibernate21.xml
│ ├── Spring.Data.NHibernate30.dll
│ ├── Spring.Data.NHibernate30.pdb
│ ├── Spring.Data.NHibernate30.xml
│ ├── Spring.Data.NHibernate31.dll
│ ├── Spring.Data.NHibernate31.pdb
│ ├── Spring.Data.NHibernate31.xml
│ ├── Spring.Data.NHibernate32.dll
│ ├── Spring.Data.NHibernate32.pdb
│ ├── Spring.Data.NHibernate32.xml
│ ├── Spring.Data.pdb
│ ├── Spring.Data.xml
│ ├── Spring.Messaging.dll
│ ├── Spring.Messaging.Ems.dll
│ ├── Spring.Messaging.Ems.pdb
│ ├── Spring.Messaging.Ems.xml
│ ├── Spring.Messaging.Nms.dll
│ ├── Spring.Messaging.Nms.pdb
│ ├── Spring.Messaging.Nms.xml
│ ├── Spring.Messaging.pdb
│ ├── Spring.Messaging.xml
│ ├── Spring.Scheduling.Quartz.dll
│ ├── Spring.Scheduling.Quartz.pdb
│ ├── Spring.Scheduling.Quartz.xml
│ ├── Spring.Services.dll
│ ├── Spring.Services.pdb
│ ├── Spring.Services.xml
│ ├── Spring.Template.Velocity.dll
│ ├── Spring.Template.Velocity.pdb
│ ├── Spring.Template.Velocity.xml
│ ├── Spring.Testing.Microsoft.dll
│ ├── Spring.Testing.Microsoft.pdb
│ ├── Spring.Testing.Microsoft.xml
│ ├── Spring.Testing.NUnit.dll
│ ├── Spring.Testing.NUnit.pdb
│ ├── Spring.Testing.NUnit.xml
│ ├── Spring.Web.dll
│ ├── Spring.Web.Extensions.dll
│ ├── Spring.Web.Extensions.pdb
│ ├── Spring.Web.Extensions.xml
│ ├── Spring.Web.Mvc3.dll
│ ├── Spring.Web.Mvc3.pdb
│ ├── Spring.Web.Mvc3.xml
│ ├── Spring.Web.Mvc.dll
│ ├── Spring.Web.Mvc.pdb
│ ├── Spring.Web.Mvc.xml
│ ├── Spring.Web.pdb
│ └── Spring.Web.xml
├── BreakingChanges.txt
├── build-support
│ ├── icons
│ │ ├── spring16.ico
│ │ ├── spring32-16.ico
│ │ ├── spring32.ico
│ │ ├── spring.ico
│ │ └── spring.pal
│ ├── solutions
│ │ ├── Spring.Net.Core.2008.sln
│ │ ├── Spring.Net.Messaging.Ems.2005.sln
│ │ ├── Spring.Net.Messaging.Ems.2008.sln
│ │ ├── Spring.Net.Messaging.Nms.2008.sln
│ │ ├── Spring.Net.NHibernate20.2005.sln
│ │ ├── Spring.Net.NHibernate20.2008.sln
│ │ ├── Spring.Net.NHibernate21.2005.sln
│ │ ├── Spring.Net.NHibernate21.2008.sln
│ │ ├── Spring.Net.NHibernate30.2008.sln
│ │ ├── Spring.Net.NHibernate31.2008.sln
│ │ ├── Spring.Net.NHibernate.sln
│ │ ├── Spring.Net.Quartz.2005.sln
│ │ ├── Spring.Net.Quartz.2008.sln
│ │ ├── Spring.Net.Template.2008.sln
│ │ └── Spring.Net.Testing.2008.sln
│ ├── solutions.build.nant
│ └── tools
│ ├── antlr-2.7.6
│ │ ├── antlr-2.7.6.exe
│ │ ├── antlr.jar
│ │ ├── charset.dll
│ │ └── libiconv-2.dll
│ ├── ncover
│ │ ├── Coverage.xsl
│ │ ├── CoverLib.dll
│ │ ├── Microsoft.VC80.CRT.manifest
│ │ ├── MSVCP80.dll
│ │ ├── MSVCR80.dll
│ │ ├── NCover.Console.exe
│ │ ├── NCover.Console.exe.config
│ │ ├── NCoverFAQ.html
│ │ └── NCover.Framework.dll
│ ├── ncoverexplorer
│ │ ├── ActiproEULA.html
│ │ ├── ActiproSoftware.Shared.Net11.dll
│ │ ├── ActiproSoftware.SyntaxEditor.Net11.dll
│ │ ├── ActiproSoftware.WinUICore.Net11.dll
│ │ ├── CommandBars.dll
│ │ ├── ConsoleConfig.xsd
│ │ ├── ConsoleExample.config
│ │ ├── CoverageReport.xsl
│ │ ├── CoverageReport.xsl.original
│ │ ├── LicencePersonal.rtf
│ │ ├── NCoverExplorer.Console.exe
│ │ ├── NCoverExplorer.Core.dll
│ │ ├── NCoverExplorer.exe
│ │ ├── NCoverExplorer.exe.config
│ │ ├── NCoverExplorerFAQ.html
│ │ ├── NCoverExplorer.NAntTasks.dll
│ │ ├── NCoverExplorer.NCoverRunner.dll
│ │ ├── NCoverExplorerReleaseNotes.html
│ │ └── NCoverExplorer.WinForms.dll
│ ├── ndoc3
│ │ ├── Interop.MSHelpCompiler.dll
│ │ ├── NDoc3Console.exe
│ │ ├── NDoc3Console.pdb
│ │ ├── NDoc3.Core.dll
│ │ ├── NDoc3.Core.pdb
│ │ ├── NDoc3.Documenter.Msdn.dll
│ │ ├── NDoc3.Documenter.Msdn.pdb
│ │ ├── NDoc3.Documenter.Xml.dll
│ │ ├── NDoc3.Documenter.Xml.pdb
│ │ ├── NDoc3.ExtendedUI.dll
│ │ ├── NDoc3.ExtendedUI.pdb
│ │ ├── NDoc3Gui.exe
│ │ ├── NDoc3Gui.exe.manifest
│ │ └── NDoc3Gui.pdb
│ └── nunit
│ ├── net-1.1
│ │ ├── agent.conf
│ │ ├── agent.log.conf
│ │ ├── framework
│ │ │ ├── nunit.framework.dll
│ │ │ ├── nunit.framework.xml
│ │ │ ├── nunit.mocks.dll
│ │ │ └── pnunit.framework.dll
│ │ ├── launcher.log.conf
│ │ ├── lib
│ │ │ ├── fit.dll
│ │ │ ├── log4net.dll
│ │ │ ├── nunit-console-runner.dll
│ │ │ ├── nunit.core.dll
│ │ │ ├── nunit.core.interfaces.dll
│ │ │ ├── nunit.fixtures.dll
│ │ │ └── nunit.util.dll
│ │ ├── nunit-agent.exe
│ │ ├── nunit-agent.exe.config
│ │ ├── nunit-console.exe
│ │ ├── nunit-console.exe.config
│ │ ├── NUnitFitTests.html
│ │ ├── nunit.framework.dll
│ │ ├── NUnitTests.config
│ │ ├── NUnitTests.nunit
│ │ ├── pnunit-agent.exe
│ │ ├── pnunit-agent.exe.config
│ │ ├── pnunit.framework.dll
│ │ ├── pnunit-launcher.exe
│ │ ├── pnunit-launcher.exe.config
│ │ ├── pnunit.tests.dll
│ │ ├── runFile.exe
│ │ ├── runFile.exe.config
│ │ ├── runpnunit.bat
│ │ ├── test.conf
│ │ └── tests
│ │ ├── loadtest-assembly.dll
│ │ ├── mock-assembly.dll
│ │ ├── nonamespace-assembly.dll
│ │ ├── nunit-console.tests.dll
│ │ ├── nunit.core.tests.dll
│ │ ├── nunit.fixtures.tests.dll
│ │ ├── nunit.framework.dll
│ │ ├── nunit.framework.tests.dll
│ │ ├── nunit.mocks.tests.dll
│ │ ├── nunit.util.tests.dll
│ │ ├── test-assembly.dll
│ │ ├── test-utilities.dll
│ │ └── timing-tests.dll
│ └── net-2.0
│ ├── agent.conf
│ ├── agent.log.conf
│ ├── framework
│ │ ├── nunit.framework.dll
│ │ ├── nunit.framework.xml
│ │ ├── nunit.mocks.dll
│ │ └── pnunit.framework.dll
│ ├── launcher.log.conf
│ ├── lib
│ │ ├── Failure.png
│ │ ├── fit.dll
│ │ ├── Ignored.png
│ │ ├── Inconclusive.png
│ │ ├── log4net.dll
│ │ ├── nunit-console-runner.dll
│ │ ├── nunit.core.dll
│ │ ├── nunit.core.interfaces.dll
│ │ ├── nunit.fixtures.dll
│ │ ├── nunit-gui-runner.dll
│ │ ├── nunit.uiexception.dll
│ │ ├── nunit.uikit.dll
│ │ ├── nunit.util.dll
│ │ ├── Skipped.png
│ │ └── Success.png
│ ├── nunit-agent.exe
│ ├── nunit-agent.exe.config
│ ├── nunit-agent-x86.exe
│ ├── nunit-agent-x86.exe.config
│ ├── nunit-console.exe
│ ├── nunit-console.exe.config
│ ├── nunit-console-x86.exe
│ ├── nunit-console-x86.exe.config
│ ├── nunit.exe
│ ├── nunit.exe.config
│ ├── NUnitFitTests.html
│ ├── nunit.framework.dll
│ ├── NUnitTests.config
│ ├── NUnitTests.nunit
│ ├── nunit-x86.exe
│ ├── nunit-x86.exe.config
│ ├── pnunit-agent.exe
│ ├── pnunit-agent.exe.config
│ ├── pnunit.framework.dll
│ ├── pnunit-launcher.exe
│ ├── pnunit-launcher.exe.config
│ ├── pnunit.tests.dll
│ ├── runFile.exe
│ ├── runFile.exe.config
│ ├── runpnunit.bat
│ ├── test.conf
│ └── tests
│ ├── loadtest-assembly.dll
│ ├── mock-assembly.dll
│ ├── nonamespace-assembly.dll
│ ├── nunit-console.tests.dll
│ ├── nunit.core.tests.dll
│ ├── nunit.fixtures.tests.dll
│ ├── nunit.framework.dll
│ ├── nunit.framework.tests.dll
│ ├── nunit-gui.tests.dll
│ ├── nunit.mocks.tests.dll
│ ├── nunit.uiexception.tests.dll
│ ├── nunit.uikit.tests.dll
│ ├── nunit.util.tests.dll
│ ├── test-assembly.dll
│ ├── test-utilities.dll
│ └── timing-tests.dll
├── changelog.txt
├── common-project.include
├── dev-support
│ ├── resharper
│ │ ├── install.txt
│ │ ├── spring_r#_file-templates.xml
│ │ └── spring_r#_live-templates.xml
│ └── vs.net-2008
│ ├── install-templates.bat
│ └── templates
│ ├── item
│ │ └── ObjectDefinitionFile.zip
│ ├── project
│ │ └── SpringClassLibrary.zip
│ └── solution
│ ├── AdoSolution
│ │ ├── ADO.NET Class Library.msi
│ │ ├── ADO.NET Class Library.wixpdb
│ │ └── ADO.NET Class Library.zip
│ ├── ClassLibrarySolution
│ │ └── Class Library.zip
│ ├── NHibernateSolution
│ │ └── NHibernate Class Library.zip
│ └── WebSolution
│ └── ASP.NET Application.zip
├── doc
│ ├── reference
│ │ ├── html
│ │ │ ├── ado.html
│ │ │ ├── ajax.html
│ │ │ ├── aop-aspect-library.html
│ │ │ ├── aop.html
│ │ │ ├── aop-quickstart.html
│ │ │ ├── background.html
│ │ │ ├── classic-spring.html
│ │ │ ├── dao.html
│ │ │ ├── data-quickstart.html
│ │ │ ├── dbprovider.html
│ │ │ ├── ems-quickstart.html
│ │ │ ├── expressions.html
│ │ │ ├── extensible-xml.html
│ │ │ ├── images
│ │ │ │ ├── admons
│ │ │ │ │ ├── annot-close.png
│ │ │ │ │ ├── annot-open.png
│ │ │ │ │ ├── blank.png
│ │ │ │ │ ├── caution.gif
│ │ │ │ │ ├── caution.png
│ │ │ │ │ ├── caution.svg
│ │ │ │ │ ├── caution.tif
│ │ │ │ │ ├── draft.png
│ │ │ │ │ ├── home.gif
│ │ │ │ │ ├── home.png
│ │ │ │ │ ├── home.svg
│ │ │ │ │ ├── important.gif
│ │ │ │ │ ├── important.png
│ │ │ │ │ ├── important.svg
│ │ │ │ │ ├── important.tif
│ │ │ │ │ ├── next.gif
│ │ │ │ │ ├── next.png
│ │ │ │ │ ├── next.svg
│ │ │ │ │ ├── note.gif
│ │ │ │ │ ├── note.png
│ │ │ │ │ ├── note.svg
│ │ │ │ │ ├── note.tif
│ │ │ │ │ ├── prev.gif
│ │ │ │ │ ├── prev.png
│ │ │ │ │ ├── prev.svg
│ │ │ │ │ ├── Thumbs.db
│ │ │ │ │ ├── tip.gif
│ │ │ │ │ ├── tip.png
│ │ │ │ │ ├── tip.svg
│ │ │ │ │ ├── tip.tif
│ │ │ │ │ ├── toc-blank.png
│ │ │ │ │ ├── toc-minus.png
│ │ │ │ │ ├── toc-plus.png
│ │ │ │ │ ├── up.gif
│ │ │ │ │ ├── up.png
│ │ │ │ │ ├── up.svg
│ │ │ │ │ ├── warning.gif
│ │ │ │ │ ├── warning.png
│ │ │ │ │ ├── warning.svg
│ │ │ │ │ └── warning.tif
│ │ │ │ ├── aop-chain.png
│ │ │ │ ├── aop-uml.gif
│ │ │ │ ├── bean-lifecycle-overview.gif
│ │ │ │ ├── callouts
│ │ │ │ │ ├── 10.gif
│ │ │ │ │ ├── 10.png
│ │ │ │ │ ├── 10.svg
│ │ │ │ │ ├── 11.gif
│ │ │ │ │ ├── 11.png
│ │ │ │ │ ├── 11.svg
│ │ │ │ │ ├── 12.gif
│ │ │ │ │ ├── 12.png
│ │ │ │ │ ├── 12.svg
│ │ │ │ │ ├── 13.gif
│ │ │ │ │ ├── 13.png
│ │ │ │ │ ├── 13.svg
│ │ │ │ │ ├── 14.gif
│ │ │ │ │ ├── 14.png
│ │ │ │ │ ├── 14.svg
│ │ │ │ │ ├── 15.gif
│ │ │ │ │ ├── 15.png
│ │ │ │ │ ├── 15.svg
│ │ │ │ │ ├── 16.svg
│ │ │ │ │ ├── 17.svg
│ │ │ │ │ ├── 18.svg
│ │ │ │ │ ├── 19.svg
│ │ │ │ │ ├── 1.gif
│ │ │ │ │ ├── 1.png
│ │ │ │ │ ├── 1.svg
│ │ │ │ │ ├── 20.svg
│ │ │ │ │ ├── 21.svg
│ │ │ │ │ ├── 22.svg
│ │ │ │ │ ├── 23.svg
│ │ │ │ │ ├── 24.svg
│ │ │ │ │ ├── 25.svg
│ │ │ │ │ ├── 26.svg
│ │ │ │ │ ├── 27.svg
│ │ │ │ │ ├── 28.svg
│ │ │ │ │ ├── 29.svg
│ │ │ │ │ ├── 2.gif
│ │ │ │ │ ├── 2.png
│ │ │ │ │ ├── 2.svg
│ │ │ │ │ ├── 30.svg
│ │ │ │ │ ├── 3.gif
│ │ │ │ │ ├── 3.png
│ │ │ │ │ ├── 3.svg
│ │ │ │ │ ├── 4.gif
│ │ │ │ │ ├── 4.png
│ │ │ │ │ ├── 4.svg
│ │ │ │ │ ├── 5.gif
│ │ │ │ │ ├── 5.png
│ │ │ │ │ ├── 5.svg
│ │ │ │ │ ├── 6.gif
│ │ │ │ │ ├── 6.png
│ │ │ │ │ ├── 6.svg
│ │ │ │ │ ├── 7.gif
│ │ │ │ │ ├── 7.png
│ │ │ │ │ ├── 7.svg
│ │ │ │ │ ├── 8.gif
│ │ │ │ │ ├── 8.png
│ │ │ │ │ ├── 8.svg
│ │ │ │ │ ├── 9.gif
│ │ │ │ │ ├── 9.png
│ │ │ │ │ ├── 9.svg
│ │ │ │ │ └── Thumbs.db
│ │ │ │ ├── container-in-action.gif
│ │ │ │ ├── DataAccessException.gif
│ │ │ │ ├── link.png
│ │ │ │ ├── logo.gif
│ │ │ │ ├── logo.jpg
│ │ │ │ ├── logo.png
│ │ │ │ ├── movie-finder.gif
│ │ │ │ ├── nh-quickstart-customer-listing.png
│ │ │ │ ├── nh-quickstart-default-screen.png
│ │ │ │ ├── nh-quickstart-domain.png
│ │ │ │ ├── nh-quickstart-edit-customer.png
│ │ │ │ ├── nh-quickstart-orders.png
│ │ │ │ ├── nh-quickstart-process.png
│ │ │ │ ├── nh-quickstart-solution-explorer.png
│ │ │ │ ├── nms-quickstart-gui.png
│ │ │ │ ├── nms-quickstart.jpg
│ │ │ │ ├── nms-quickstart-msg-destinations.jpg
│ │ │ │ ├── overview.gif
│ │ │ │ ├── remoting-solution.gif
│ │ │ │ ├── remoting-startup.gif
│ │ │ │ ├── resharper-file-templates.png
│ │ │ │ ├── resharper-live-prop-def.png
│ │ │ │ ├── resharper-live-templates.png
│ │ │ │ ├── resharper-property-ref-1.png
│ │ │ │ ├── resharper-property-ref-2.png
│ │ │ │ ├── resharper-property-ref-3.png
│ │ │ │ ├── resharper-type-completion-1.png
│ │ │ │ ├── resharper-type-completion-2.png
│ │ │ │ ├── resharper-type-completion-3.png
│ │ │ │ ├── resharper-type-completion-4.png
│ │ │ │ ├── S2-banner-rhs.png
│ │ │ │ ├── spring-triangle.png
│ │ │ │ ├── spring.windows-service.png
│ │ │ │ ├── Thumbs.db
│ │ │ │ ├── tx.png
│ │ │ │ ├── vsnet-ado-sln.png
│ │ │ │ ├── vsnet-classlib-sln.png
│ │ │ │ ├── vsnet-nh-sln.png
│ │ │ │ ├── vsnet-solution-templates.png
│ │ │ │ ├── vsnet-web-sln.png
│ │ │ │ ├── web-exporter-calc-svc-aop-add001.jpg
│ │ │ │ ├── web-exporter-calc-svc-aop-add.jpg
│ │ │ │ ├── web-exporter-calc-svc-aop.jpg
│ │ │ │ ├── web-exporter-calc-svc.jpg
│ │ │ │ ├── web-exporter-calc-svc-main.jpg
│ │ │ │ └── xdev-spring_logo.jpg
│ │ │ ├── index.html
│ │ │ ├── introduction.html
│ │ │ ├── javadevelopers.html
│ │ │ ├── logging.html
│ │ │ ├── messaging-ems.html
│ │ │ ├── messaging.html
│ │ │ ├── migration.html
│ │ │ ├── misc.html
│ │ │ ├── msmq.html
│ │ │ ├── msmq-quickstart.html
│ │ │ ├── nh-quickstart.html
│ │ │ ├── nms-quickstart.html
│ │ │ ├── objects.html
│ │ │ ├── objects-misc.html
│ │ │ ├── orm.html
│ │ │ ├── pool.html
│ │ │ ├── preface.html
│ │ │ ├── psa-intro.html
│ │ │ ├── quartz-quickstart.html
│ │ │ ├── quickstarts.html
│ │ │ ├── remoting.html
│ │ │ ├── remoting-quickstart.html
│ │ │ ├── resources.html
│ │ │ ├── scheduling.html
│ │ │ ├── services.html
│ │ │ ├── springair.html
│ │ │ ├── spring-appendices.html
│ │ │ ├── spring-core.html
│ │ │ ├── spring-integration.html
│ │ │ ├── spring-javadevelopers.html
│ │ │ ├── spring-middle-tier.html
│ │ │ ├── springobjectsxsd.html
│ │ │ ├── spring-quickstarts.html
│ │ │ ├── spring-services.html
│ │ │ ├── spring-vsnet.html
│ │ │ ├── spring-web.html
│ │ │ ├── styles
│ │ │ │ └── html.css
│ │ │ ├── templating.html
│ │ │ ├── testing.html
│ │ │ ├── threading.html
│ │ │ ├── transaction.html
│ │ │ ├── tx-quickstart.html
│ │ │ ├── validation.html
│ │ │ ├── vsnet.html
│ │ │ ├── wcf.html
│ │ │ ├── wcf-quickstart.html
│ │ │ ├── web.html
│ │ │ ├── web-mvc3.html
│ │ │ ├── web-mvc.html
│ │ │ ├── web-quickstart.html
│ │ │ ├── webservices.html
│ │ │ └── xsd-config.html
│ │ ├── htmlhelp
│ │ │ └── spring-net-reference.chm
│ │ └── pdf
│ │ └── spring-net-reference.pdf
│ ├── schema
│ │ ├── install-schema.build
│ │ ├── spring-aop-1.1.xsd
│ │ ├── spring-database-1.3.xsd
│ │ ├── spring-ems-1.3.xsd
│ │ ├── spring-nms-1.3.xsd
│ │ ├── spring-nvelocity-1.3.xsd
│ │ ├── spring-objects-1.3.xsd
│ │ ├── spring-remoting-1.1.xsd
│ │ ├── spring-tool-1.1.xsd
│ │ ├── spring-tx-1.1.xsd
│ │ ├── spring-validation-1.3.xsd
│ │ └── spring-wcf-1.3.xsd
│ └── sdk
├── examples
│ └── Spring
│ ├── SpringAir
│ │ ├── data
│ │ │ ├── access
│ │ │ │ └── readme.txt
│ │ │ ├── msde
│ │ │ │ ├── create.sql
│ │ │ │ └── populate.sql
│ │ │ ├── mysql
│ │ │ │ ├── create.sql
│ │ │ │ ├── drop.sql
│ │ │ │ ├── populate.sql
│ │ │ │ ├── readme.txt
│ │ │ │ ├── refresh.sql
│ │ │ │ └── schema.sql
│ │ │ ├── oracle
│ │ │ │ ├── create.sql
│ │ │ │ ├── drop.sql
│ │ │ │ ├── populate.sql
│ │ │ │ ├── readme.txt
│ │ │ │ ├── refresh.sql
│ │ │ │ └── schema.sql
│ │ │ └── readme.txt
│ │ ├── readme.txt
│ │ ├── SpringAir.2003.sln
│ │ ├── SpringAir.2005.sln
│ │ ├── SpringAir.2008.sln
│ │ ├── SpringAir.2010.sln
│ │ ├── SpringAir.build
│ │ ├── src
│ │ │ ├── SpringAir.Core
│ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ ├── Data
│ │ │ │ │ ├── IAircraftDao.cs
│ │ │ │ │ ├── IAirportDao.cs
│ │ │ │ │ └── IFlightDao.cs
│ │ │ │ ├── Domain
│ │ │ │ │ ├── Aircraft.cs
│ │ │ │ │ ├── AirportCollection.cs
│ │ │ │ │ ├── Airport.cs
│ │ │ │ │ ├── CabinClass.cs
│ │ │ │ │ ├── Cabin.cs
│ │ │ │ │ ├── Entity.cs
│ │ │ │ │ ├── FlightCollection.cs
│ │ │ │ │ ├── Flight.cs
│ │ │ │ │ ├── FlightSuggestions.cs
│ │ │ │ │ ├── Itinerary.cs
│ │ │ │ │ ├── Passenger.cs
│ │ │ │ │ ├── ReservationConfirmation.cs
│ │ │ │ │ ├── Reservation.cs
│ │ │ │ │ ├── Seat.cs
│ │ │ │ │ ├── TimeRange.cs
│ │ │ │ │ ├── Trip.cs
│ │ │ │ │ ├── TripMode.cs
│ │ │ │ │ └── TripPoint.cs
│ │ │ │ ├── Service
│ │ │ │ │ ├── CannotConfirmReservationException.cs
│ │ │ │ │ ├── DefaultBookingAgent.cs
│ │ │ │ │ └── IBookingAgent.cs
│ │ │ │ ├── SpringAir.Core.2003.csproj
│ │ │ │ ├── SpringAir.Core.2005.csproj
│ │ │ │ ├── SpringAir.Core.2008.csproj
│ │ │ │ ├── SpringAir.Core.2010.csproj
│ │ │ │ └── SpringAir.Core.build
│ │ │ ├── SpringAir.Data.Ado
│ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ ├── Data
│ │ │ │ │ └── Ado
│ │ │ │ │ ├── AircraftDao.cs
│ │ │ │ │ ├── AircraftMapper.cs
│ │ │ │ │ ├── AirportDao.cs
│ │ │ │ │ ├── AirportMapper.cs
│ │ │ │ │ ├── FlightDao.cs
│ │ │ │ │ └── ItineraryDao.cs
│ │ │ │ ├── SpringAir.Data.Ado.2003.csproj
│ │ │ │ ├── SpringAir.Data.Ado.2005.csproj
│ │ │ │ ├── SpringAir.Data.Ado.2008.csproj
│ │ │ │ ├── SpringAir.Data.Ado.2010.csproj
│ │ │ │ └── SpringAir.Data.Ado.build
│ │ │ ├── SpringAir.Web.2003
│ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ ├── Config
│ │ │ │ │ ├── Aspects.xml
│ │ │ │ │ ├── Log4Net.xml
│ │ │ │ │ ├── Production
│ │ │ │ │ │ ├── Dao.xml
│ │ │ │ │ │ └── Services.xml
│ │ │ │ │ ├── Services.xml
│ │ │ │ │ ├── Test
│ │ │ │ │ │ ├── Dao.xml
│ │ │ │ │ │ └── Services.xml
│ │ │ │ │ └── Web.xml
│ │ │ │ ├── Constants.cs
│ │ │ │ ├── Global.asax
│ │ │ │ ├── Global.asax.cs
│ │ │ │ ├── Global.asax.resx
│ │ │ │ ├── Resources
│ │ │ │ │ ├── Strings.en.resx
│ │ │ │ │ ├── Strings.resx
│ │ │ │ │ ├── Strings.sr-SP-Cyrl.resx
│ │ │ │ │ └── Strings.sr-SP-Latn.resx
│ │ │ │ ├── Scripts
│ │ │ │ │ └── Calendar
│ │ │ │ │ ├── calendar-blue2.css
│ │ │ │ │ ├── calendar-blue.css
│ │ │ │ │ ├── calendar-brown.css
│ │ │ │ │ ├── calendar-green.css
│ │ │ │ │ ├── calendar.js
│ │ │ │ │ ├── calendar-setup.js
│ │ │ │ │ ├── calendar-system.css
│ │ │ │ │ ├── calendar-tas.css
│ │ │ │ │ ├── calendar-win2k-1.css
│ │ │ │ │ ├── calendar-win2k-2.css
│ │ │ │ │ ├── calendar-win2k-cold-1.css
│ │ │ │ │ ├── calendar-win2k-cold-2.css
│ │ │ │ │ ├── img.gif
│ │ │ │ │ └── lang
│ │ │ │ │ ├── calendar-af.js
│ │ │ │ │ ├── calendar-al.js
│ │ │ │ │ ├── calendar-bg.js
│ │ │ │ │ ├── calendar-big5.js
│ │ │ │ │ ├── calendar-big5-utf8.js
│ │ │ │ │ ├── calendar-br.js
│ │ │ │ │ ├── calendar-ca.js
│ │ │ │ │ ├── calendar-cs-utf8.js
│ │ │ │ │ ├── calendar-cs-win.js
│ │ │ │ │ ├── calendar-da.js
│ │ │ │ │ ├── calendar-de.js
│ │ │ │ │ ├── calendar-du.js
│ │ │ │ │ ├── calendar-el.js
│ │ │ │ │ ├── calendar-en-gb.js
│ │ │ │ │ ├── calendar-en.js
│ │ │ │ │ ├── calendar-en-US.js
│ │ │ │ │ ├── calendar-es.js
│ │ │ │ │ ├── calendar-fi.js
│ │ │ │ │ ├── calendar-fr.js
│ │ │ │ │ ├── calendar-he-utf8.js
│ │ │ │ │ ├── calendar-hr.js
│ │ │ │ │ ├── calendar-hr-utf8.js
│ │ │ │ │ ├── calendar-hu.js
│ │ │ │ │ ├── calendar-it.js
│ │ │ │ │ ├── calendar-jp.js
│ │ │ │ │ ├── calendar-ko.js
│ │ │ │ │ ├── calendar-ko-utf8.js
│ │ │ │ │ ├── calendar-lt.js
│ │ │ │ │ ├── calendar-lt-utf8.js
│ │ │ │ │ ├── calendar-lv.js
│ │ │ │ │ ├── calendar-nl.js
│ │ │ │ │ ├── calendar-no.js
│ │ │ │ │ ├── calendar-pl.js
│ │ │ │ │ ├── calendar-pl-utf8.js
│ │ │ │ │ ├── calendar-pt.js
│ │ │ │ │ ├── calendar-ro.js
│ │ │ │ │ ├── calendar-ru.js
│ │ │ │ │ ├── calendar-ru_win_.js
│ │ │ │ │ ├── calendar-si.js
│ │ │ │ │ ├── calendar-sk.js
│ │ │ │ │ ├── calendar-sp.js
│ │ │ │ │ ├── calendar-sr-SP-Cyrl.js
│ │ │ │ │ ├── calendar-sr-SP-Latn.js
│ │ │ │ │ ├── calendar-sv.js
│ │ │ │ │ ├── calendar-tr.js
│ │ │ │ │ ├── calendar-zh.js
│ │ │ │ │ └── cn_utf8.js
│ │ │ │ ├── SpringAir.Web.2003.csproj
│ │ │ │ ├── SpringAir.Web.2003.csproj.webinfo
│ │ │ │ ├── SpringAir.Web.build
│ │ │ │ ├── Web
│ │ │ │ │ ├── BookTrip
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.cs
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.en.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.sr-SP-Cyrl.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.sr-SP-Latn.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.cs
│ │ │ │ │ │ ├── SuggestedFlights.aspx.resx
│ │ │ │ │ │ ├── SuggestedFlights.en.resx
│ │ │ │ │ │ ├── SuggestedFlights.sr-SP-Cyrl.resx
│ │ │ │ │ │ ├── SuggestedFlights.sr-SP-Latn.resx
│ │ │ │ │ │ ├── TripForm.aspx
│ │ │ │ │ │ ├── TripForm.aspx.cs
│ │ │ │ │ │ ├── TripForm.aspx.resx
│ │ │ │ │ │ ├── TripForm.en.resx
│ │ │ │ │ │ ├── TripForm.sr-SP-Cyrl.resx
│ │ │ │ │ │ ├── TripForm.sr-SP-Latn.resx
│ │ │ │ │ │ └── Web.config
│ │ │ │ │ ├── CSS
│ │ │ │ │ │ └── default.css
│ │ │ │ │ ├── Home.aspx
│ │ │ │ │ ├── Home.aspx.cs
│ │ │ │ │ ├── Home.aspx.resx
│ │ │ │ │ ├── Images
│ │ │ │ │ │ ├── calendar-1.gif
│ │ │ │ │ │ ├── calendar-2.gif
│ │ │ │ │ │ ├── en
│ │ │ │ │ │ │ └── spring-air-logo.jpg
│ │ │ │ │ │ ├── line.jpg
│ │ │ │ │ │ ├── panel-bottom-left.gif
│ │ │ │ │ │ ├── panel-bottom-middle.gif
│ │ │ │ │ │ ├── panel-bottom-right.gif
│ │ │ │ │ │ ├── panel-left-middle.gif
│ │ │ │ │ │ ├── panel-right-middle.gif
│ │ │ │ │ │ ├── panel-top-left.gif
│ │ │ │ │ │ ├── panel-top-middle.gif
│ │ │ │ │ │ ├── panel-top-right.gif
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ ├── sr-SP-Cyrl
│ │ │ │ │ │ │ └── spring-air-logo.jpg
│ │ │ │ │ │ ├── sr-SP-Latn
│ │ │ │ │ │ │ └── spring-air-logo.jpg
│ │ │ │ │ │ └── validation-error.gif
│ │ │ │ │ ├── StandardTemplate.ascx
│ │ │ │ │ ├── StandardTemplate.ascx.cs
│ │ │ │ │ ├── StandardTemplate.ascx.resx
│ │ │ │ │ └── Web.config
│ │ │ │ └── Web.config
│ │ │ ├── SpringAir.Web.2005
│ │ │ │ ├── App_Code
│ │ │ │ │ └── Constants.cs
│ │ │ │ ├── App_GlobalResources
│ │ │ │ │ ├── Strings.en.resx
│ │ │ │ │ ├── Strings.resx
│ │ │ │ │ ├── Strings.sr-Cyrl-CS.resx
│ │ │ │ │ ├── Strings.sr-Latn-CS.resx
│ │ │ │ │ ├── Strings.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ └── Strings.sr-SP-Latn.resx.exclude
│ │ │ │ ├── Config
│ │ │ │ │ ├── Aspects.xml
│ │ │ │ │ ├── Log4Net.xml
│ │ │ │ │ ├── Production
│ │ │ │ │ │ ├── Dao.xml
│ │ │ │ │ │ └── Services.xml
│ │ │ │ │ ├── Services.xml
│ │ │ │ │ ├── Test
│ │ │ │ │ │ ├── Dao.xml
│ │ │ │ │ │ └── Services.xml
│ │ │ │ │ ├── Validation.xml
│ │ │ │ │ └── Web.xml
│ │ │ │ ├── Global.asax
│ │ │ │ ├── Scripts
│ │ │ │ │ └── Calendar
│ │ │ │ │ ├── calendar-blue2.css
│ │ │ │ │ ├── calendar-blue.css
│ │ │ │ │ ├── calendar-brown.css
│ │ │ │ │ ├── calendar-green.css
│ │ │ │ │ ├── calendar.js
│ │ │ │ │ ├── calendar-setup.js
│ │ │ │ │ ├── calendar-system.css
│ │ │ │ │ ├── calendar-tas.css
│ │ │ │ │ ├── calendar-win2k-1.css
│ │ │ │ │ ├── calendar-win2k-2.css
│ │ │ │ │ ├── calendar-win2k-cold-1.css
│ │ │ │ │ ├── calendar-win2k-cold-2.css
│ │ │ │ │ ├── img.gif
│ │ │ │ │ └── lang
│ │ │ │ │ ├── calendar-af.js
│ │ │ │ │ ├── calendar-al.js
│ │ │ │ │ ├── calendar-bg.js
│ │ │ │ │ ├── calendar-big5.js
│ │ │ │ │ ├── calendar-big5-utf8.js
│ │ │ │ │ ├── calendar-br.js
│ │ │ │ │ ├── calendar-ca.js
│ │ │ │ │ ├── calendar-cs-utf8.js
│ │ │ │ │ ├── calendar-cs-win.js
│ │ │ │ │ ├── calendar-da.js
│ │ │ │ │ ├── calendar-de.js
│ │ │ │ │ ├── calendar-du.js
│ │ │ │ │ ├── calendar-el.js
│ │ │ │ │ ├── calendar-en-gb.js
│ │ │ │ │ ├── calendar-en.js
│ │ │ │ │ ├── calendar-en-US.js
│ │ │ │ │ ├── calendar-es.js
│ │ │ │ │ ├── calendar-fi.js
│ │ │ │ │ ├── calendar-fr.js
│ │ │ │ │ ├── calendar-he-utf8.js
│ │ │ │ │ ├── calendar-hr.js
│ │ │ │ │ ├── calendar-hr-utf8.js
│ │ │ │ │ ├── calendar-hu.js
│ │ │ │ │ ├── calendar-it.js
│ │ │ │ │ ├── calendar-jp.js
│ │ │ │ │ ├── calendar-ko.js
│ │ │ │ │ ├── calendar-ko-utf8.js
│ │ │ │ │ ├── calendar-lt.js
│ │ │ │ │ ├── calendar-lt-utf8.js
│ │ │ │ │ ├── calendar-lv.js
│ │ │ │ │ ├── calendar-nl.js
│ │ │ │ │ ├── calendar-no.js
│ │ │ │ │ ├── calendar-pl.js
│ │ │ │ │ ├── calendar-pl-utf8.js
│ │ │ │ │ ├── calendar-pt.js
│ │ │ │ │ ├── calendar-ro.js
│ │ │ │ │ ├── calendar-ru.js
│ │ │ │ │ ├── calendar-ru_win_.js
│ │ │ │ │ ├── calendar-si.js
│ │ │ │ │ ├── calendar-sk.js
│ │ │ │ │ ├── calendar-sp.js
│ │ │ │ │ ├── calendar-sr-SP-Cyrl.js
│ │ │ │ │ ├── calendar-sr-SP-Latn.js
│ │ │ │ │ ├── calendar-sv.js
│ │ │ │ │ ├── calendar-tr.js
│ │ │ │ │ ├── calendar-zh.js
│ │ │ │ │ └── cn_utf8.js
│ │ │ │ ├── SpringAir.Web.build
│ │ │ │ ├── Web
│ │ │ │ │ ├── App_LocalResources
│ │ │ │ │ │ ├── Home.aspx.resx
│ │ │ │ │ │ └── StandardTemplate.master.resx
│ │ │ │ │ ├── BookTrip
│ │ │ │ │ │ ├── App_LocalResources
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.en.resx
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.resx
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.en.resx
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.resx
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ │ ├── TripForm.aspx.en.resx
│ │ │ │ │ │ │ ├── TripForm.aspx.resx
│ │ │ │ │ │ │ ├── TripForm.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ │ ├── TripForm.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ │ ├── TripForm.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ │ └── TripForm.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ ├── BookTrip.aspx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.cs
│ │ │ │ │ │ ├── SuggestedFlights.aspx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.cs
│ │ │ │ │ │ ├── TripForm.aspx
│ │ │ │ │ │ ├── TripForm.aspx.cs
│ │ │ │ │ │ └── Web.config
│ │ │ │ │ ├── CSS
│ │ │ │ │ │ └── default.css
│ │ │ │ │ ├── Home.aspx
│ │ │ │ │ ├── Home.aspx.cs
│ │ │ │ │ ├── Images
│ │ │ │ │ │ ├── calendar-1.gif
│ │ │ │ │ │ ├── calendar-2.gif
│ │ │ │ │ │ ├── en
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── error.gif
│ │ │ │ │ │ ├── line.jpg
│ │ │ │ │ │ ├── panel-bottom-left.gif
│ │ │ │ │ │ ├── panel-bottom-middle.gif
│ │ │ │ │ │ ├── panel-bottom-right.gif
│ │ │ │ │ │ ├── panel-left-middle.gif
│ │ │ │ │ │ ├── panel-right-middle.gif
│ │ │ │ │ │ ├── panel-top-left.gif
│ │ │ │ │ │ ├── panel-top-middle.gif
│ │ │ │ │ │ ├── panel-top-right.gif
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ ├── sr-Cyrl-CS
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── sr-Latn-CS
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── sr-SP-Cyrl
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── sr-SP-Latn
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── Thumbs.db
│ │ │ │ │ │ └── validation-error.gif
│ │ │ │ │ ├── StandardTemplate.master
│ │ │ │ │ ├── StandardTemplate.master.cs
│ │ │ │ │ └── Web.config
│ │ │ │ └── Web.config
│ │ │ ├── SpringAir.Web.2005.References
│ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ ├── SpringAir.Web.2005.References.csproj
│ │ │ │ ├── SpringAir.Web.2008.References.csproj
│ │ │ │ └── SpringAir.Web.2010.References.csproj
│ │ │ └── SpringAir.Web.2010
│ │ │ ├── App_Code
│ │ │ │ └── Constants.cs
│ │ │ ├── App_GlobalResources
│ │ │ │ ├── Strings.en.resx
│ │ │ │ ├── Strings.resx
│ │ │ │ ├── Strings.sr-Cyrl-CS.resx
│ │ │ │ ├── Strings.sr-Latn-CS.resx
│ │ │ │ ├── Strings.sr-SP-Cyrl.resx.exclude
│ │ │ │ └── Strings.sr-SP-Latn.resx.exclude
│ │ │ ├── Config
│ │ │ │ ├── Aspects.xml
│ │ │ │ ├── Log4Net.xml
│ │ │ │ ├── Production
│ │ │ │ │ ├── Dao.xml
│ │ │ │ │ └── Services.xml
│ │ │ │ ├── Services.xml
│ │ │ │ ├── Test
│ │ │ │ │ ├── Dao.xml
│ │ │ │ │ └── Services.xml
│ │ │ │ ├── Validation.xml
│ │ │ │ └── Web.xml
│ │ │ ├── Global.asax
│ │ │ ├── Scripts
│ │ │ │ └── Calendar
│ │ │ │ ├── calendar-blue2.css
│ │ │ │ ├── calendar-blue.css
│ │ │ │ ├── calendar-brown.css
│ │ │ │ ├── calendar-green.css
│ │ │ │ ├── calendar.js
│ │ │ │ ├── calendar-setup.js
│ │ │ │ ├── calendar-system.css
│ │ │ │ ├── calendar-tas.css
│ │ │ │ ├── calendar-win2k-1.css
│ │ │ │ ├── calendar-win2k-2.css
│ │ │ │ ├── calendar-win2k-cold-1.css
│ │ │ │ ├── calendar-win2k-cold-2.css
│ │ │ │ ├── img.gif
│ │ │ │ └── lang
│ │ │ │ ├── calendar-af.js
│ │ │ │ ├── calendar-al.js
│ │ │ │ ├── calendar-bg.js
│ │ │ │ ├── calendar-big5.js
│ │ │ │ ├── calendar-big5-utf8.js
│ │ │ │ ├── calendar-br.js
│ │ │ │ ├── calendar-ca.js
│ │ │ │ ├── calendar-cs-utf8.js
│ │ │ │ ├── calendar-cs-win.js
│ │ │ │ ├── calendar-da.js
│ │ │ │ ├── calendar-de.js
│ │ │ │ ├── calendar-du.js
│ │ │ │ ├── calendar-el.js
│ │ │ │ ├── calendar-en-gb.js
│ │ │ │ ├── calendar-en.js
│ │ │ │ ├── calendar-en-US.js
│ │ │ │ ├── calendar-es.js
│ │ │ │ ├── calendar-fi.js
│ │ │ │ ├── calendar-fr.js
│ │ │ │ ├── calendar-he-utf8.js
│ │ │ │ ├── calendar-hr.js
│ │ │ │ ├── calendar-hr-utf8.js
│ │ │ │ ├── calendar-hu.js
│ │ │ │ ├── calendar-it.js
│ │ │ │ ├── calendar-jp.js
│ │ │ │ ├── calendar-ko.js
│ │ │ │ ├── calendar-ko-utf8.js
│ │ │ │ ├── calendar-lt.js
│ │ │ │ ├── calendar-lt-utf8.js
│ │ │ │ ├── calendar-lv.js
│ │ │ │ ├── calendar-nl.js
│ │ │ │ ├── calendar-no.js
│ │ │ │ ├── calendar-pl.js
│ │ │ │ ├── calendar-pl-utf8.js
│ │ │ │ ├── calendar-pt.js
│ │ │ │ ├── calendar-ro.js
│ │ │ │ ├── calendar-ru.js
│ │ │ │ ├── calendar-ru_win_.js
│ │ │ │ ├── calendar-si.js
│ │ │ │ ├── calendar-sk.js
│ │ │ │ ├── calendar-sp.js
│ │ │ │ ├── calendar-sr-SP-Cyrl.js
│ │ │ │ ├── calendar-sr-SP-Latn.js
│ │ │ │ ├── calendar-sv.js
│ │ │ │ ├── calendar-tr.js
│ │ │ │ ├── calendar-zh.js
│ │ │ │ └── cn_utf8.js
│ │ │ ├── SpringAir.Web.build
│ │ │ ├── Web
│ │ │ │ ├── App_LocalResources
│ │ │ │ │ ├── Home.aspx.resx
│ │ │ │ │ └── StandardTemplate.master.resx
│ │ │ │ ├── BookTrip
│ │ │ │ │ ├── App_LocalResources
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.en.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ ├── SuggestedFlights.aspx.en.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ ├── TripForm.aspx.en.resx
│ │ │ │ │ │ ├── TripForm.aspx.resx
│ │ │ │ │ │ ├── TripForm.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ ├── TripForm.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ ├── TripForm.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ └── TripForm.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ ├── BookTrip.aspx
│ │ │ │ │ ├── ReservationConfirmationPage.aspx
│ │ │ │ │ ├── ReservationConfirmationPage.aspx.cs
│ │ │ │ │ ├── SuggestedFlights.aspx
│ │ │ │ │ ├── SuggestedFlights.aspx.cs
│ │ │ │ │ ├── TripForm.aspx
│ │ │ │ │ ├── TripForm.aspx.cs
│ │ │ │ │ └── Web.config
│ │ │ │ ├── CSS
│ │ │ │ │ └── default.css
│ │ │ │ ├── Home.aspx
│ │ │ │ ├── Home.aspx.cs
│ │ │ │ ├── Images
│ │ │ │ │ ├── calendar-1.gif
│ │ │ │ │ ├── calendar-2.gif
│ │ │ │ │ ├── en
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── error.gif
│ │ │ │ │ ├── line.jpg
│ │ │ │ │ ├── panel-bottom-left.gif
│ │ │ │ │ ├── panel-bottom-middle.gif
│ │ │ │ │ ├── panel-bottom-right.gif
│ │ │ │ │ ├── panel-left-middle.gif
│ │ │ │ │ ├── panel-right-middle.gif
│ │ │ │ │ ├── panel-top-left.gif
│ │ │ │ │ ├── panel-top-middle.gif
│ │ │ │ │ ├── panel-top-right.gif
│ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ ├── sr-Cyrl-CS
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── sr-Latn-CS
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── sr-SP-Cyrl
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── sr-SP-Latn
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── Thumbs.db
│ │ │ │ │ └── validation-error.gif
│ │ │ │ ├── StandardTemplate.master
│ │ │ │ ├── StandardTemplate.master.cs
│ │ │ │ └── Web.config
│ │ │ └── Web.config
│ │ └── test
│ │ ├── SpringAir.Core.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Domain
│ │ │ │ ├── FlightCollectionTests.cs
│ │ │ │ ├── FlightSuggestionsTests.cs
│ │ │ │ ├── FlightTests.cs
│ │ │ │ ├── ReservationConfirmationTests.cs
│ │ │ │ └── TimeRangeTests.cs
│ │ │ ├── Service
│ │ │ │ ├── BookingAgentIntegrationTests.cs
│ │ │ │ └── DefaultBookingAgentIntegrationTests.cs
│ │ │ ├── SpringAir.Core.Tests.2003.csproj
│ │ │ ├── SpringAir.Core.Tests.2005.csproj
│ │ │ ├── SpringAir.Core.Tests.2008.csproj
│ │ │ ├── SpringAir.Core.Tests.2010.csproj
│ │ │ └── SpringAir.Core.Tests.build
│ │ └── SpringAir.Data.Ado.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── Ado
│ │ │ ├── AircraftDaoTests.cs
│ │ │ ├── AirportDaoTests.cs
│ │ │ ├── FlightDaoTests.cs
│ │ │ └── ReflectiveDbConnectionFactoryTests.cs
│ │ ├── SpringAir.Data.Ado.Tests.2003.csproj
│ │ ├── SpringAir.Data.Ado.Tests.2005.csproj
│ │ ├── SpringAir.Data.Ado.Tests.2008.csproj
│ │ ├── SpringAir.Data.Ado.Tests.2010.csproj
│ │ └── SpringAir.Data.Ado.Tests.build
│ ├── Spring.AopQuickStart
│ │ ├── readme.txt
│ │ ├── Spring.AopQuickStart.2003.sln
│ │ ├── Spring.AopQuickStart.2005.sln
│ │ ├── Spring.AopQuickStart.2008.sln
│ │ ├── Spring.AopQuickStart.2010.sln
│ │ ├── Spring.AopQuickStart.build
│ │ └── src
│ │ ├── Spring.AopQuickStart.Common
│ │ │ ├── Aspects
│ │ │ │ ├── ConsoleLoggingAfterAdvice.cs
│ │ │ │ ├── ConsoleLoggingAroundAdvice.cs
│ │ │ │ ├── ConsoleLoggingBeforeAdvice.cs
│ │ │ │ └── ConsoleLoggingThrowsAdvice.cs
│ │ │ ├── Commands
│ │ │ │ ├── ICommand.cs
│ │ │ │ └── ServiceCommand.cs
│ │ │ ├── Spring.AopQuickStart.Common.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Common.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Common.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Common.2010.csproj
│ │ │ └── Spring.AopQuickStart.Common.build
│ │ ├── Spring.AopQuickStart.Step1
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step1.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step1.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step1.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step1.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step1.build
│ │ ├── Spring.AopQuickStart.Step2
│ │ │ ├── App.config
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step2.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step2.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step2.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step2.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step2.build
│ │ ├── Spring.AopQuickStart.Step3
│ │ │ ├── App.config
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step3.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step3.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step3.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step3.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step3.build
│ │ ├── Spring.AopQuickStart.Step4
│ │ │ ├── App.config
│ │ │ ├── Aspects
│ │ │ │ └── ConsoleLoggingAdvice.cs
│ │ │ ├── Attributes
│ │ │ │ └── ConsoleLoggingAttribute.cs
│ │ │ ├── Commands
│ │ │ │ └── AnotherServiceCommand.cs
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step4.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step4.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step4.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step4.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step4.build
│ │ ├── Spring.AopQuickStart.Step5
│ │ │ ├── App.config
│ │ │ ├── Aspects
│ │ │ │ └── ExpressionDynamicPointcutAdvisor.cs
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step5.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step5.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step5.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step5.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step5.build
│ │ ├── Spring.AopQuickStart.Step6
│ │ │ ├── App.config
│ │ │ ├── Contact.cs
│ │ │ ├── IIsModified.cs
│ │ │ ├── IsModifiedMixin.cs
│ │ │ ├── ModificationAdvice.cs
│ │ │ ├── ModificationAdvisor.cs
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step6.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step6.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step6.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step6.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step6.build
│ │ └── Spring.AopQuickStart.Step7
│ │ ├── App.config
│ │ ├── Commands
│ │ │ └── AnotherServiceCommand.cs
│ │ ├── Program.cs
│ │ ├── Spring.AopQuickStart.Step7.2003.csproj
│ │ ├── Spring.AopQuickStart.Step7.2005.csproj
│ │ ├── Spring.AopQuickStart.Step7.2008.csproj
│ │ ├── Spring.AopQuickStart.Step7.2010.csproj
│ │ └── Spring.AopQuickStart.Step7.build
│ ├── Spring.CachingQuickStart
│ │ ├── Spring.CachingQuickStart.2008.sln
│ │ ├── Spring.CachingQuickStart.2010.sln
│ │ └── src
│ │ └── Spring.CachingQuickStart.Web
│ │ ├── Default.aspx
│ │ ├── Default.aspx.cs
│ │ ├── Default.aspx.designer.cs
│ │ ├── Services
│ │ │ ├── IMovieService.cs
│ │ │ ├── Movie.cs
│ │ │ └── MovieService.cs
│ │ ├── Spring.CachingQuickStart.Web.2008.csproj
│ │ ├── Spring.CachingQuickStart.Web.2010.csproj
│ │ ├── Spring.config
│ │ └── Web.config
│ ├── Spring.Calculator
│ │ ├── lib
│ │ │ └── net
│ │ │ ├── 1.1
│ │ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ │ └── log4net.dll
│ │ │ └── 2.0
│ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ └── log4net.dll
│ │ ├── readme.txt
│ │ ├── Spring.Calculator.2003.sln
│ │ ├── Spring.Calculator.2005.sln
│ │ ├── Spring.Calculator.2008.sln
│ │ ├── Spring.Calculator.2010.sln
│ │ ├── Spring.Calculator.build
│ │ ├── Spring.Calculator.snk
│ │ ├── Spring.Calculator.Web.2005
│ │ └── src
│ │ ├── Spring.Aspects
│ │ │ ├── Logging
│ │ │ │ ├── CommonLoggingAroundAdvice.cs
│ │ │ │ └── ConsoleLoggingAroundAdvice.cs
│ │ │ ├── Spring.Aspects.2003.csproj
│ │ │ ├── Spring.Aspects.2005.csproj
│ │ │ ├── Spring.Aspects.2008.csproj
│ │ │ ├── Spring.Aspects.2010.csproj
│ │ │ └── Spring.Aspects.build
│ │ ├── Spring.Calculator.ClientApp
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── EnterpriseServices
│ │ │ │ │ └── enterpriseServices.xml
│ │ │ │ ├── InProcess
│ │ │ │ │ └── inProcess.xml
│ │ │ │ ├── Remoting
│ │ │ │ │ ├── cao-aop.xml
│ │ │ │ │ ├── cao-ctor-aop.xml
│ │ │ │ │ ├── cao-ctor.xml
│ │ │ │ │ ├── cao.xml
│ │ │ │ │ ├── saoSingleCall-aop.xml
│ │ │ │ │ ├── saoSingleCall.xml
│ │ │ │ │ ├── saoSingleton-aop.xml
│ │ │ │ │ └── saoSingleton.xml
│ │ │ │ ├── WebServices
│ │ │ │ │ ├── calculatorService.wsdl
│ │ │ │ │ ├── webServices-aop.xml
│ │ │ │ │ └── webServices.xml
│ │ │ │ ├── WebServices2003
│ │ │ │ │ ├── calculatorService.wsdl
│ │ │ │ │ ├── webServices-aop.xml
│ │ │ │ │ └── webServices.xml
│ │ │ │ └── WebServices2005
│ │ │ │ ├── calculatorService.wsdl
│ │ │ │ ├── webServices-aop.xml
│ │ │ │ └── webServices.xml
│ │ │ ├── Program.cs
│ │ │ ├── Spring.Calculator.ClientApp.2003.csproj
│ │ │ ├── Spring.Calculator.ClientApp.2005.csproj
│ │ │ ├── Spring.Calculator.ClientApp.2008.csproj
│ │ │ ├── Spring.Calculator.ClientApp.2010.csproj
│ │ │ └── Spring.Calculator.ClientApp.build
│ │ ├── Spring.Calculator.Contract
│ │ │ ├── Domain
│ │ │ │ └── DivisionResult.cs
│ │ │ ├── Interfaces
│ │ │ │ ├── IAdvancedCalculator.cs
│ │ │ │ └── ICalculator.cs
│ │ │ ├── Spring.Calculator.Contract.2003.csproj
│ │ │ ├── Spring.Calculator.Contract.2005.csproj
│ │ │ ├── Spring.Calculator.Contract.2008.csproj
│ │ │ ├── Spring.Calculator.Contract.2010.csproj
│ │ │ └── Spring.Calculator.Contract.build
│ │ ├── Spring.Calculator.RegisterComponentServices
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ └── services.xml
│ │ │ ├── Program.cs
│ │ │ ├── Spring.Calculator.EnterpriseServices.dll.config
│ │ │ ├── Spring.Calculator.EnterpriseServices.exe.config
│ │ │ ├── Spring.Calculator.RegisterComponentServices.2003.csproj
│ │ │ ├── Spring.Calculator.RegisterComponentServices.2005.csproj
│ │ │ ├── Spring.Calculator.RegisterComponentServices.2008.csproj
│ │ │ ├── Spring.Calculator.RegisterComponentServices.2010.csproj
│ │ │ └── Spring.Calculator.RegisterComponentServices.build
│ │ ├── Spring.Calculator.RemoteApp
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── cao-aop.xml
│ │ │ │ ├── cao.xml
│ │ │ │ ├── saoSingleCall-aop.xml
│ │ │ │ ├── saoSingleCall.xml
│ │ │ │ ├── saoSingleton-aop.xml
│ │ │ │ └── saoSingleton.xml
│ │ │ ├── Program.cs
│ │ │ ├── Spring.Calculator.RemoteApp.2003.csproj
│ │ │ ├── Spring.Calculator.RemoteApp.2005.csproj
│ │ │ ├── Spring.Calculator.RemoteApp.2008.csproj
│ │ │ ├── Spring.Calculator.RemoteApp.2010.csproj
│ │ │ └── Spring.Calculator.RemoteApp.build
│ │ ├── Spring.Calculator.Services
│ │ │ ├── Services
│ │ │ │ ├── AdvancedCalculator.cs
│ │ │ │ └── Calculator.cs
│ │ │ ├── Spring.Calculator.Services.2003.csproj
│ │ │ ├── Spring.Calculator.Services.2005.csproj
│ │ │ ├── Spring.Calculator.Services.2008.csproj
│ │ │ ├── Spring.Calculator.Services.2010.csproj
│ │ │ └── Spring.Calculator.Services.build
│ │ ├── Spring.Calculator.Web
│ │ │ ├── Config
│ │ │ │ ├── webServices-aop.xml
│ │ │ │ └── webServices.xml
│ │ │ ├── Default.aspx
│ │ │ ├── Spring.Calculator.Web.2008.csproj
│ │ │ ├── Spring.Calculator.Web.2010.csproj
│ │ │ └── Web.config
│ │ ├── Spring.Calculator.Web.2003
│ │ │ ├── Config
│ │ │ │ ├── webServices-aop.xml
│ │ │ │ └── webServices.xml
│ │ │ ├── Default.aspx
│ │ │ ├── Spring.Calculator.Web.2003.csproj
│ │ │ ├── Spring.Calculator.Web.2003.csproj.webinfo
│ │ │ └── Web.config
│ │ └── Spring.Calculator.Web.2005
│ │ ├── App_Code
│ │ ├── Bin
│ │ │ ├── Common.Logging.dll.refresh
│ │ │ ├── Common.Logging.Log4Net.dll.refresh
│ │ │ ├── log4net.dll.refresh
│ │ │ ├── Spring.Aop.dll.refresh
│ │ │ ├── Spring.Core.dll.refresh
│ │ │ ├── Spring.Services.dll.refresh
│ │ │ └── Spring.Web.dll.refresh
│ │ ├── Config
│ │ │ ├── webServices-aop.xml
│ │ │ └── webServices.xml
│ │ ├── Default.aspx
│ │ └── Web.config
│ ├── Spring.Data.NHibernate.Northwind
│ │ ├── lib
│ │ │ └── net
│ │ │ └── 2.0
│ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ └── System.Data.SQLite.DLL
│ │ ├── readme.txt
│ │ ├── Spring.Northwind.2008.sln
│ │ ├── Spring.Northwind.2010.sln
│ │ ├── src
│ │ │ ├── Spring.Northwind.Dao
│ │ │ │ ├── Dao
│ │ │ │ │ ├── ICustomerDao.cs
│ │ │ │ │ ├── IDao.cs
│ │ │ │ │ ├── IOrderDao.cs
│ │ │ │ │ ├── IProductDao.cs
│ │ │ │ │ ├── ISupportsDeleteDao.cs
│ │ │ │ │ └── ISupportsSave.cs
│ │ │ │ ├── Domain
│ │ │ │ │ ├── Customer.cs
│ │ │ │ │ ├── DefaultCustomerClassificationCalculator.cs
│ │ │ │ │ ├── DomainClassDiagram.cd
│ │ │ │ │ ├── ICustomerClassificationCalculator.cs
│ │ │ │ │ ├── ICustomer.cs
│ │ │ │ │ ├── Order.cs
│ │ │ │ │ ├── OrderDetail.cs
│ │ │ │ │ └── Product.cs
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.Northwind.Dao.2008.csproj
│ │ │ │ ├── Spring.Northwind.Dao.2010.csproj
│ │ │ │ └── Spring.Northwind.Dao.csproj
│ │ │ ├── Spring.Northwind.Dao.NHibernate
│ │ │ │ ├── Dao
│ │ │ │ │ ├── Dao.xml
│ │ │ │ │ └── NHibernate
│ │ │ │ │ ├── CustomLocalSessionFactoryObject.cs
│ │ │ │ │ ├── HibernateCustomerDao.cs
│ │ │ │ │ ├── HibernateDao.cs
│ │ │ │ │ ├── HibernateOrderDao.cs
│ │ │ │ │ └── HibernateProductDao.cs
│ │ │ │ ├── Mappings
│ │ │ │ │ ├── Customer.hbm.xml
│ │ │ │ │ ├── Oracle
│ │ │ │ │ │ └── Customer.hbm.xml
│ │ │ │ │ ├── OrderDetail.hbm.xml
│ │ │ │ │ └── Order.hbm.xml
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.Northwind.Dao.NHibernate.2008.csproj
│ │ │ │ ├── Spring.Northwind.Dao.NHibernate.2010.csproj
│ │ │ │ └── Spring.Northwind.Dao.NHibernate.csproj
│ │ │ ├── Spring.Northwind.Service
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Service
│ │ │ │ │ ├── FedExShippingService.cs
│ │ │ │ │ ├── FulfillmentService.cs
│ │ │ │ │ ├── IFulfillmentService.cs
│ │ │ │ │ ├── IShippingService.cs
│ │ │ │ │ └── Services.xml
│ │ │ │ ├── Spring.Northwind.Service.2008.csproj
│ │ │ │ ├── Spring.Northwind.Service.2010.csproj
│ │ │ │ └── Spring.Northwind.Service.csproj
│ │ │ ├── Spring.Northwind.Web
│ │ │ │ ├── App_Code
│ │ │ │ │ ├── ICustomerEditController.cs
│ │ │ │ │ └── NHibernateCustomerEditController.cs
│ │ │ │ ├── App_Data
│ │ │ │ │ └── Northwind.db
│ │ │ │ ├── App_Themes
│ │ │ │ │ └── Spring
│ │ │ │ │ └── Spring.skin
│ │ │ │ ├── Config
│ │ │ │ │ ├── Aspects.xml
│ │ │ │ │ └── Log4Net.xml
│ │ │ │ ├── CSS
│ │ │ │ │ └── style.css
│ │ │ │ ├── CustomerEditor.aspx
│ │ │ │ ├── CustomerEditor.aspx.cs
│ │ │ │ ├── CustomerList.aspx
│ │ │ │ ├── CustomerList.aspx.cs
│ │ │ │ ├── CustomerOrders.aspx
│ │ │ │ ├── CustomerOrders.aspx.cs
│ │ │ │ ├── CustomerView.aspx
│ │ │ │ ├── CustomerView.aspx.cs
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ ├── FulfillmentResult.aspx
│ │ │ │ ├── FulfillmentResult.aspx.cs
│ │ │ │ ├── Global.asax
│ │ │ │ ├── Img
│ │ │ │ │ ├── bg-spring.png
│ │ │ │ │ ├── footern.gif
│ │ │ │ │ ├── header-spring.png
│ │ │ │ │ ├── logo.png
│ │ │ │ │ └── springNet_release.png
│ │ │ │ ├── Shared
│ │ │ │ │ ├── MasterPage.master
│ │ │ │ │ └── MasterPage.master.cs
│ │ │ │ ├── Web.config
│ │ │ │ └── Web.xml
│ │ │ └── Spring.Northwind.Web.References
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.Northwind.Web.References.2008.csproj
│ │ │ ├── Spring.Northwind.Web.References.2010.csproj
│ │ │ ├── Spring.Northwind.Web.References.csproj
│ │ │ └── Spring.Northwind.Web.References.Debug.csproj
│ │ ├── test
│ │ │ └── Spring.Northwind.IntegrationTests
│ │ │ ├── App.config
│ │ │ ├── IntegrationTests
│ │ │ │ ├── AbstractDaoIntegrationTests.cs
│ │ │ │ ├── FulfillmentServiceTests.cs
│ │ │ │ └── NorthwindIntegrationTests.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.Northwind.IntegrationTests.2008.csproj
│ │ │ ├── Spring.Northwind.IntegrationTests.2010.csproj
│ │ │ └── Spring.Northwind.IntegrationTests.csproj
│ │ └── test_northwind.sql
│ ├── Spring.DataQuickStart
│ │ ├── Spring.DataQuickStart.2003.sln
│ │ ├── Spring.DataQuickStart.2005.sln
│ │ ├── Spring.DataQuickStart.2008.sln
│ │ ├── Spring.DataQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── CommonAssemblyInfo.cs
│ │ │ └── Spring.DataQuickStart
│ │ │ ├── DataQuickStart
│ │ │ │ ├── Dao
│ │ │ │ │ ├── GenericTemplate
│ │ │ │ │ │ ├── CommandCallbackDao.cs
│ │ │ │ │ │ ├── CustomerRowMapper.cs
│ │ │ │ │ │ ├── CustOrdersDetailStoredProc.cs
│ │ │ │ │ │ ├── OrderDetailRowMapper.cs
│ │ │ │ │ │ ├── QueryForObjectDao.cs
│ │ │ │ │ │ ├── ResultSetExtractorDao.cs
│ │ │ │ │ │ ├── RowCallbackDao.cs
│ │ │ │ │ │ └── RowMapperDao.cs
│ │ │ │ │ └── Template
│ │ │ │ │ ├── CommandCallbackDao.cs
│ │ │ │ │ ├── CustomerDataSetDao.cs
│ │ │ │ │ ├── CustomerRowMapper.cs
│ │ │ │ │ ├── CustOrdersDetailStoredProc.cs
│ │ │ │ │ ├── OrderDetailRowMapper.cs
│ │ │ │ │ ├── QueryForObjectDao.cs
│ │ │ │ │ ├── ResultSetExtractorDao.cs
│ │ │ │ │ ├── RowCallbackDao.cs
│ │ │ │ │ └── RowMapperDao.cs
│ │ │ │ └── Domain
│ │ │ │ ├── Customer.cs
│ │ │ │ └── OrderDetails.cs
│ │ │ ├── Spring.DataQuickStart.2003.csproj
│ │ │ ├── Spring.DataQuickStart.2005.csproj
│ │ │ ├── Spring.DataQuickStart.2008.csproj
│ │ │ └── Spring.DataQuickStart.2010.csproj
│ │ └── test
│ │ └── Spring
│ │ └── Spring.DataQuickStart.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── DataQuickStart
│ │ │ ├── GenericTemplate
│ │ │ │ ├── ExampleTests.cs
│ │ │ │ └── ExampleTests.xml
│ │ │ └── Template
│ │ │ ├── ExampleTests.cs
│ │ │ └── ExampleTests.xml
│ │ ├── Spring.DataQuickStart.Tests.2003.csproj
│ │ ├── Spring.DataQuickStart.Tests.2005.csproj
│ │ ├── Spring.DataQuickStart.Tests.2008.csproj
│ │ ├── Spring.DataQuickStart.Tests.2010.csproj
│ │ └── Spring.DataQuickStart.Tests.dll.config
│ ├── Spring.EmsQuickStart
│ │ ├── Spring.EmsQuickStart.2008.sln
│ │ ├── Spring.EmsQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── Spring.EmsQuickStart.Client
│ │ │ │ ├── App.config
│ │ │ │ ├── Config
│ │ │ │ │ ├── Application.xml
│ │ │ │ │ └── Messaging.xml
│ │ │ │ ├── Gateways
│ │ │ │ │ ├── EmsStockServiceGateway.cs
│ │ │ │ │ ├── EmsSyncStockServiceGateway.cs
│ │ │ │ │ ├── IStockService.cs
│ │ │ │ │ ├── ISyncStockService.cs
│ │ │ │ │ └── RequestReplyEmsTemplate.cs
│ │ │ │ ├── Handlers
│ │ │ │ │ └── StockAppHandler.cs
│ │ │ │ ├── Program.cs
│ │ │ │ ├── Properties
│ │ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ │ ├── Resources.Designer.cs
│ │ │ │ │ ├── Resources.resx
│ │ │ │ │ ├── Settings.Designer.cs
│ │ │ │ │ └── Settings.settings
│ │ │ │ ├── Spring.EmsQuickStart.Client.2010.csproj
│ │ │ │ ├── Spring.EmsQuickStart.Client.csproj
│ │ │ │ └── UI
│ │ │ │ ├── StockController.cs
│ │ │ │ ├── StockForm.cs
│ │ │ │ ├── StockForm.designer.cs
│ │ │ │ └── StockForm.resx
│ │ │ ├── Spring.EmsQuickStart.Common
│ │ │ │ ├── Bo
│ │ │ │ │ ├── Trade.cs
│ │ │ │ │ └── TradeRequest.cs
│ │ │ │ ├── Converters
│ │ │ │ │ ├── AbstractNamedMessageConverter.cs
│ │ │ │ │ ├── INamedMessageConverter.cs
│ │ │ │ │ ├── ITypeMapper.cs
│ │ │ │ │ ├── MultiMessageConverter.cs
│ │ │ │ │ ├── TradeConverter.cs
│ │ │ │ │ ├── TradeRequestConverter.cs
│ │ │ │ │ ├── TypeMapper.cs
│ │ │ │ │ └── XmlMessageConverter.cs
│ │ │ │ ├── Data
│ │ │ │ │ ├── generate-classes.bat
│ │ │ │ │ ├── TradeRequest.cs
│ │ │ │ │ ├── TradeRequest.xsd
│ │ │ │ │ ├── TradeRequest.xsx
│ │ │ │ │ ├── TradeResponse.cs
│ │ │ │ │ ├── TradeResponse.xsd
│ │ │ │ │ └── TradeResponse.xsx
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.EmsQuickStart.Common.2010.csproj
│ │ │ │ └── Spring.EmsQuickStart.Common.csproj
│ │ │ └── Spring.EmsQuickStart.Server
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── Handlers.xml
│ │ │ │ ├── Messaging.xml
│ │ │ │ └── ServiceStubs.xml
│ │ │ ├── Gateways
│ │ │ │ ├── IMarketDataService.cs
│ │ │ │ └── MarketDataServiceGateway.cs
│ │ │ ├── Handlers
│ │ │ │ ├── LoggingExceptionListener.cs
│ │ │ │ └── StockAppHandler.cs
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Services
│ │ │ │ ├── ICreditCheckService.cs
│ │ │ │ ├── IExecutionVenueService.cs
│ │ │ │ ├── ITradingService.cs
│ │ │ │ └── Stubs
│ │ │ │ ├── CreditCheckServiceStub.cs
│ │ │ │ ├── ExecutionVenueServiceStub.cs
│ │ │ │ └── TradingServiceStub.cs
│ │ │ ├── Spring.EmsQuickStart.Server.2010.csproj
│ │ │ └── Spring.EmsQuickStart.Server.csproj
│ │ └── test
│ │ └── Spring
│ │ ├── Spring.EmsQuickStart.Integration.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Spring.EmsQuickStart.Integration.Tests.2008.csproj
│ │ │ └── Spring.EmsQuickStart.Integration.Tests.2010.csproj
│ │ └── Spring.EmsQuickStart.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.EmsQuickStart.Tests.2008.csproj
│ │ └── Spring.EmsQuickStart.Tests.2010.csproj
│ ├── Spring.Examples.build
│ ├── Spring.IoCQuickStart.AppContext
│ │ ├── Spring.IocQuickStart.AppContext.2003.sln
│ │ ├── Spring.IocQuickStart.AppContext.2005.sln
│ │ ├── Spring.IocQuickStart.AppContext.2008.sln
│ │ ├── Spring.IocQuickStart.AppContext.2010.sln
│ │ ├── Spring.IocQuickStart.AppContext.build
│ │ └── src
│ │ ├── App.config
│ │ ├── AppContext
│ │ │ ├── Images.resx
│ │ │ ├── Keys.cs
│ │ │ ├── MyResource.es.resx
│ │ │ ├── MyResource.resx
│ │ │ ├── Person.cs
│ │ │ ├── Person.resx
│ │ │ ├── Program.cs
│ │ │ ├── ResourcesDisplayForm.cs
│ │ │ └── ResourcesDisplayForm.resx
│ │ ├── Spring.IocQuickStart.AppContext.2003.csproj
│ │ ├── Spring.IocQuickStart.AppContext.2005.csproj
│ │ ├── Spring.IocQuickStart.AppContext.2008.csproj
│ │ └── Spring.IocQuickStart.AppContext.2010.csproj
│ ├── Spring.IoCQuickStart.EventRegistry
│ │ ├── Spring.IocQuickStart.EventRegistry.2003.sln
│ │ ├── Spring.IocQuickStart.EventRegistry.2005.sln
│ │ ├── Spring.IocQuickStart.EventRegistry.2008.sln
│ │ ├── Spring.IocQuickStart.EventRegistry.2010.sln
│ │ ├── Spring.IocQuickStart.EventRegistry.build
│ │ └── src
│ │ ├── App.config
│ │ ├── EventRegistry
│ │ │ ├── MyClientEventArgs.cs
│ │ │ ├── MyEventPublisher.cs
│ │ │ ├── MyEventSubscriber.cs
│ │ │ └── Program.cs
│ │ ├── Spring.IocQuickStart.EventRegistry.2003.csproj
│ │ ├── Spring.IocQuickStart.EventRegistry.2005.csproj
│ │ ├── Spring.IocQuickStart.EventRegistry.2008.csproj
│ │ └── Spring.IocQuickStart.EventRegistry.2010.csproj
│ ├── Spring.IoCQuickStart.MovieFinder
│ │ ├── lib
│ │ │ └── net
│ │ │ ├── 1.0
│ │ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ │ └── log4net.dll
│ │ │ ├── 1.1
│ │ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ │ └── log4net.dll
│ │ │ └── 2.0
│ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ └── log4net.dll
│ │ ├── Spring.IocQuickStart.MovieFinder.2003.sln
│ │ ├── Spring.IocQuickStart.MovieFinder.2005.sln
│ │ ├── Spring.IocQuickStart.MovieFinder.2008.sln
│ │ ├── Spring.IocQuickStart.MovieFinder.2010.sln
│ │ ├── Spring.IocQuickStart.MovieFinder.build
│ │ └── src
│ │ ├── App.config
│ │ ├── MovieFinder
│ │ │ ├── AppContextContribution.xml
│ │ │ ├── AppContext.xml
│ │ │ ├── ColonDelimitedMovieFinder.cs
│ │ │ ├── IMovieFinder.cs
│ │ │ ├── Movie.cs
│ │ │ ├── MovieLister.cs
│ │ │ ├── movies.txt
│ │ │ ├── Program.cs
│ │ │ └── SimpleMovieFinder.cs
│ │ ├── Spring.IocQuickStart.MovieFinder.2003.csproj
│ │ ├── Spring.IocQuickStart.MovieFinder.2005.csproj
│ │ ├── Spring.IocQuickStart.MovieFinder.2008.csproj
│ │ └── Spring.IocQuickStart.MovieFinder.2010.csproj
│ ├── Spring.MsmqQuickStart
│ │ ├── Spring.MsmqQuickStart.2005.sln
│ │ ├── Spring.MsmqQuickStart.2008.sln
│ │ ├── Spring.MsmqQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── Spring.MsmqQuickStart.Client
│ │ │ │ ├── App.config
│ │ │ │ ├── Config
│ │ │ │ │ ├── Application.xml
│ │ │ │ │ └── Messaging.xml
│ │ │ │ ├── Gateways
│ │ │ │ │ ├── IStockService.cs
│ │ │ │ │ └── MsmqStockServiceGateway.cs
│ │ │ │ ├── Handlers
│ │ │ │ │ └── StockAppHandler.cs
│ │ │ │ ├── Program.cs
│ │ │ │ ├── Properties
│ │ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ │ ├── Resources.Designer.cs
│ │ │ │ │ ├── Resources.resx
│ │ │ │ │ ├── Settings.Designer.cs
│ │ │ │ │ └── Settings.settings
│ │ │ │ ├── Spring.MsmqQuickStart.Client.2008.csproj
│ │ │ │ ├── Spring.MsmqQuickStart.Client.2010.csproj
│ │ │ │ ├── Spring.MsmqQuickStart.Client.csproj
│ │ │ │ └── UI
│ │ │ │ ├── StockController.cs
│ │ │ │ ├── StockForm.cs
│ │ │ │ ├── StockForm.designer.cs
│ │ │ │ └── StockForm.resx
│ │ │ ├── Spring.MsmqQuickStart.Common
│ │ │ │ ├── Data
│ │ │ │ │ ├── TradeRequest.cs
│ │ │ │ │ ├── TradeRequest.xsd
│ │ │ │ │ ├── TradeRequest.xsx
│ │ │ │ │ ├── TradeResponse.cs
│ │ │ │ │ ├── TradeResponse.xsd
│ │ │ │ │ └── TradeResponse.xsx
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.MsmqQuickStart.Common.2008.csproj
│ │ │ │ ├── Spring.MsmqQuickStart.Common.2010.csproj
│ │ │ │ └── Spring.MsmqQuickStart.Common.csproj
│ │ │ └── Spring.MsmqQuickStart.Server
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── Handlers.xml
│ │ │ │ ├── Messaging.xml
│ │ │ │ └── ServiceStubs.xml
│ │ │ ├── Gateways
│ │ │ │ ├── IMarketDataService.cs
│ │ │ │ └── MarketDataServiceGateway.cs
│ │ │ ├── Handlers
│ │ │ │ └── StockAppHandler.cs
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Services
│ │ │ │ ├── ICreditCheckService.cs
│ │ │ │ ├── IExecutionVenueService.cs
│ │ │ │ ├── ITradingService.cs
│ │ │ │ └── Stubs
│ │ │ │ ├── CreditCheckServiceStub.cs
│ │ │ │ ├── ExecutionVenueServiceStub.cs
│ │ │ │ └── TradingServiceStub.cs
│ │ │ ├── Spring.MsmqQuickStart.Server.2008.csproj
│ │ │ ├── Spring.MsmqQuickStart.Server.2010.csproj
│ │ │ └── Spring.MsmqQuickStart.Server.csproj
│ │ └── test
│ │ └── Spring
│ │ ├── Spring.MsmqQuickStart.Integration.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Spring.MsmqQuickStart.Integration.Tests.2005.csproj
│ │ │ └── Spring.MsmqQuickStart.Integration.Tests.2010.csproj
│ │ └── Spring.MsmqQuickStart.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.MsmqQuickStart.Tests.2005.csproj
│ │ └── Spring.MsmqQuickStart.Tests.2010.csproj
│ ├── Spring.Mvc3QuickStart
│ │ ├── packages
│ │ │ ├── EntityFramework.4.1.10331.0
│ │ │ │ ├── EntityFramework.4.1.10331.0.nupkg
│ │ │ │ └── lib
│ │ │ │ ├── EntityFramework.dll
│ │ │ │ └── EntityFramework.xml
│ │ │ ├── jQuery.1.5.1
│ │ │ │ ├── Content
│ │ │ │ │ └── Scripts
│ │ │ │ │ ├── jquery-1.5.1.js
│ │ │ │ │ └── jquery-1.5.1.min.js
│ │ │ │ └── jQuery.1.5.1.nupkg
│ │ │ ├── jQuery.UI.Combined.1.8.11
│ │ │ │ ├── Content
│ │ │ │ │ ├── Content
│ │ │ │ │ │ └── themes
│ │ │ │ │ │ └── base
│ │ │ │ │ │ ├── images
│ │ │ │ │ │ │ ├── ui-bg_flat_0_aaaaaa_40x100.png
│ │ │ │ │ │ │ ├── ui-bg_flat_75_ffffff_40x100.png
│ │ │ │ │ │ │ ├── ui-bg_glass_55_fbf9ee_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_glass_65_ffffff_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_glass_75_dadada_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_glass_75_e6e6e6_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_glass_95_fef1ec_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_highlight-soft_75_cccccc_1x100.png
│ │ │ │ │ │ │ ├── ui-icons_222222_256x240.png
│ │ │ │ │ │ │ ├── ui-icons_2e83ff_256x240.png
│ │ │ │ │ │ │ ├── ui-icons_454545_256x240.png
│ │ │ │ │ │ │ ├── ui-icons_888888_256x240.png
│ │ │ │ │ │ │ └── ui-icons_cd0a0a_256x240.png
│ │ │ │ │ │ ├── jquery.ui.accordion.css
│ │ │ │ │ │ ├── jquery.ui.all.css
│ │ │ │ │ │ ├── jquery.ui.autocomplete.css
│ │ │ │ │ │ ├── jquery.ui.base.css
│ │ │ │ │ │ ├── jquery.ui.button.css
│ │ │ │ │ │ ├── jquery.ui.core.css
│ │ │ │ │ │ ├── jquery.ui.datepicker.css
│ │ │ │ │ │ ├── jquery.ui.dialog.css
│ │ │ │ │ │ ├── jquery.ui.progressbar.css
│ │ │ │ │ │ ├── jquery.ui.resizable.css
│ │ │ │ │ │ ├── jquery.ui.selectable.css
│ │ │ │ │ │ ├── jquery.ui.slider.css
│ │ │ │ │ │ ├── jquery.ui.tabs.css
│ │ │ │ │ │ └── jquery.ui.theme.css
│ │ │ │ │ └── Scripts
│ │ │ │ │ ├── jquery-ui-1.8.11.js
│ │ │ │ │ └── jquery-ui-1.8.11.min.js
│ │ │ │ └── jQuery.UI.Combined.1.8.11.nupkg
│ │ │ ├── jQuery.Validation.1.8.0
│ │ │ │ ├── Content
│ │ │ │ │ └── Scripts
│ │ │ │ │ ├── jquery.validate.js
│ │ │ │ │ ├── jquery.validate.min.js
│ │ │ │ │ └── jquery.validate-vsdoc.js
│ │ │ │ └── jQuery.Validation.1.8.0.nupkg
│ │ │ ├── jQuery.vsdoc.1.5.1
│ │ │ │ ├── Content
│ │ │ │ │ └── Scripts
│ │ │ │ │ └── jquery-1.5.1-vsdoc.js
│ │ │ │ └── jQuery.vsdoc.1.5.1.nupkg
│ │ │ ├── Modernizr.1.7
│ │ │ │ ├── Content
│ │ │ │ │ └── Scripts
│ │ │ │ │ ├── modernizr-1.7.js
│ │ │ │ │ └── modernizr-1.7.min.js
│ │ │ │ └── Modernizr.1.7.nupkg
│ │ │ └── repositories.config
│ │ ├── Spring.Mvc3QuickStart.sln
│ │ ├── Spring.Mvc3QuickStart.sln.docstates
│ │ └── src
│ │ └── Spring.Mvc3QuickStart
│ │ ├── App_Data
│ │ ├── Config
│ │ │ └── controllers.xml
│ │ ├── Content
│ │ │ ├── Site.css
│ │ │ └── themes
│ │ │ └── base
│ │ │ ├── images
│ │ │ │ ├── ui-bg_flat_0_aaaaaa_40x100.png
│ │ │ │ ├── ui-bg_flat_75_ffffff_40x100.png
│ │ │ │ ├── ui-bg_glass_55_fbf9ee_1x400.png
│ │ │ │ ├── ui-bg_glass_65_ffffff_1x400.png
│ │ │ │ ├── ui-bg_glass_75_dadada_1x400.png
│ │ │ │ ├── ui-bg_glass_75_e6e6e6_1x400.png
│ │ │ │ ├── ui-bg_glass_95_fef1ec_1x400.png
│ │ │ │ ├── ui-bg_highlight-soft_75_cccccc_1x100.png
│ │ │ │ ├── ui-icons_222222_256x240.png
│ │ │ │ ├── ui-icons_2e83ff_256x240.png
│ │ │ │ ├── ui-icons_454545_256x240.png
│ │ │ │ ├── ui-icons_888888_256x240.png
│ │ │ │ └── ui-icons_cd0a0a_256x240.png
│ │ │ ├── jquery.ui.accordion.css
│ │ │ ├── jquery.ui.all.css
│ │ │ ├── jquery.ui.autocomplete.css
│ │ │ ├── jquery.ui.base.css
│ │ │ ├── jquery.ui.button.css
│ │ │ ├── jquery.ui.core.css
│ │ │ ├── jquery.ui.datepicker.css
│ │ │ ├── jquery.ui.dialog.css
│ │ │ ├── jquery.ui.progressbar.css
│ │ │ ├── jquery.ui.resizable.css
│ │ │ ├── jquery.ui.selectable.css
│ │ │ ├── jquery.ui.slider.css
│ │ │ ├── jquery.ui.tabs.css
│ │ │ └── jquery.ui.theme.css
│ │ ├── Controllers
│ │ │ ├── AccountController.cs
│ │ │ └── HomeController.cs
│ │ ├── Global.asax
│ │ ├── Global.asax.cs
│ │ ├── Models
│ │ │ └── AccountModels.cs
│ │ ├── packages.config
│ │ ├── Properties
│ │ │ └── AssemblyInfo.cs
│ │ ├── Scripts
│ │ │ ├── jquery-1.5.1.js
│ │ │ ├── jquery-1.5.1.min.js
│ │ │ ├── jquery-1.5.1-vsdoc.js
│ │ │ ├── jquery-ui-1.8.11.js
│ │ │ ├── jquery-ui-1.8.11.min.js
│ │ │ ├── jquery.unobtrusive-ajax.js
│ │ │ ├── jquery.unobtrusive-ajax.min.js
│ │ │ ├── jquery.validate.js
│ │ │ ├── jquery.validate.min.js
│ │ │ ├── jquery.validate.unobtrusive.js
│ │ │ ├── jquery.validate.unobtrusive.min.js
│ │ │ ├── jquery.validate-vsdoc.js
│ │ │ ├── MicrosoftAjax.debug.js
│ │ │ ├── MicrosoftAjax.js
│ │ │ ├── MicrosoftMvcAjax.debug.js
│ │ │ ├── MicrosoftMvcAjax.js
│ │ │ ├── MicrosoftMvcValidation.debug.js
│ │ │ ├── MicrosoftMvcValidation.js
│ │ │ ├── modernizr-1.7.js
│ │ │ └── modernizr-1.7.min.js
│ │ ├── Spring.Mvc3QuickStart.csproj
│ │ ├── Views
│ │ │ ├── Account
│ │ │ │ ├── ChangePassword.cshtml
│ │ │ │ ├── ChangePasswordSuccess.cshtml
│ │ │ │ ├── LogOn.cshtml
│ │ │ │ └── Register.cshtml
│ │ │ ├── Home
│ │ │ │ ├── About.cshtml
│ │ │ │ └── Index.cshtml
│ │ │ ├── Shared
│ │ │ │ ├── Error.cshtml
│ │ │ │ ├── _Layout.cshtml
│ │ │ │ └── _LogOnPartial.cshtml
│ │ │ ├── _ViewStart.cshtml
│ │ │ └── Web.config
│ │ ├── Web.config
│ │ ├── Web.Debug.config
│ │ └── Web.Release.config
│ ├── Spring.MvcQuickStart
│ │ ├── Spring.MvcQuickStart.2010.sln
│ │ └── src
│ │ └── Spring.MvcQuickStart
│ │ ├── App_Data
│ │ ├── Config
│ │ │ └── controllers.xml
│ │ ├── Content
│ │ │ └── Site.css
│ │ ├── Controllers
│ │ │ ├── AccountController.cs
│ │ │ └── HomeController.cs
│ │ ├── Global.asax
│ │ ├── Global.asax.cs
│ │ ├── Models
│ │ │ └── AccountModels.cs
│ │ ├── Properties
│ │ │ └── AssemblyInfo.cs
│ │ ├── Scripts
│ │ │ ├── jquery-1.4.1.js
│ │ │ ├── jquery-1.4.1.min.js
│ │ │ ├── jquery-1.4.1-vsdoc.js
│ │ │ ├── jquery.validate.js
│ │ │ ├── jquery.validate.min.js
│ │ │ ├── jquery.validate-vsdoc.js
│ │ │ ├── MicrosoftAjax.debug.js
│ │ │ ├── MicrosoftAjax.js
│ │ │ ├── MicrosoftMvcAjax.debug.js
│ │ │ ├── MicrosoftMvcAjax.js
│ │ │ ├── MicrosoftMvcValidation.debug.js
│ │ │ └── MicrosoftMvcValidation.js
│ │ ├── Spring.MvcQuickStart.2010.csproj
│ │ ├── Views
│ │ │ ├── Account
│ │ │ │ ├── ChangePassword.aspx
│ │ │ │ ├── ChangePasswordSuccess.aspx
│ │ │ │ ├── LogOn.aspx
│ │ │ │ └── Register.aspx
│ │ │ ├── Home
│ │ │ │ ├── About.aspx
│ │ │ │ └── Index.aspx
│ │ │ ├── Shared
│ │ │ │ ├── Error.aspx
│ │ │ │ ├── LogOnUserControl.ascx
│ │ │ │ └── Site.Master
│ │ │ └── Web.config
│ │ ├── Web.config
│ │ ├── Web.Debug.config
│ │ └── Web.Release.config
│ ├── Spring.NmsQuickStart
│ │ ├── Spring.NmsQuickStart.2005.sln
│ │ ├── Spring.NmsQuickStart.2008.sln
│ │ ├── Spring.NmsQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── Spring.NmsQuickStart.Client
│ │ │ │ ├── App.config
│ │ │ │ ├── Config
│ │ │ │ │ ├── Application.xml
│ │ │ │ │ └── Messaging.xml
│ │ │ │ ├── Gateways
│ │ │ │ │ ├── IStockService.cs
│ │ │ │ │ ├── ISyncStockService.cs
│ │ │ │ │ ├── NmsStockServiceGateway.cs
│ │ │ │ │ ├── NmsSyncStockServiceGateway.cs
│ │ │ │ │ └── RequestReplyNmsTemplate.cs
│ │ │ │ ├── Handlers
│ │ │ │ │ └── StockAppHandler.cs
│ │ │ │ ├── Program.cs
│ │ │ │ ├── Properties
│ │ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ │ ├── Resources.Designer.cs
│ │ │ │ │ ├── Resources.resx
│ │ │ │ │ ├── Settings.Designer.cs
│ │ │ │ │ └── Settings.settings
│ │ │ │ ├── Spring.NmsQuickStart.Client.2008.csproj
│ │ │ │ ├── Spring.NmsQuickStart.Client.2010.csproj
│ │ │ │ ├── Spring.NmsQuickStart.Client.csproj
│ │ │ │ └── UI
│ │ │ │ ├── StockController.cs
│ │ │ │ ├── StockForm.cs
│ │ │ │ ├── StockForm.designer.cs
│ │ │ │ └── StockForm.resx
│ │ │ ├── Spring.NmsQuickStart.Common
│ │ │ │ ├── Bo
│ │ │ │ │ ├── Trade.cs
│ │ │ │ │ └── TradeRequest.cs
│ │ │ │ ├── Converters
│ │ │ │ │ ├── AbstractNamedMessageConverter.cs
│ │ │ │ │ ├── INamedMessageConverter.cs
│ │ │ │ │ ├── ITypeMapper.cs
│ │ │ │ │ ├── MultiMessageConverter.cs
│ │ │ │ │ ├── TradeConverter.cs
│ │ │ │ │ ├── TradeRequestConverter.cs
│ │ │ │ │ ├── TypeMapper.cs
│ │ │ │ │ └── XmlMessageConverter.cs
│ │ │ │ ├── Data
│ │ │ │ │ ├── generate-classes.bat
│ │ │ │ │ ├── TradeRequest.cs
│ │ │ │ │ ├── TradeRequest.xsd
│ │ │ │ │ ├── TradeRequest.xsx
│ │ │ │ │ ├── TradeResponse.cs
│ │ │ │ │ ├── TradeResponse.xsd
│ │ │ │ │ └── TradeResponse.xsx
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.NmsQuickStart.Common.2008.csproj
│ │ │ │ ├── Spring.NmsQuickStart.Common.2010.csproj
│ │ │ │ └── Spring.NmsQuickStart.Common.csproj
│ │ │ └── Spring.NmsQuickStart.Server
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── Handlers.xml
│ │ │ │ ├── Messaging.xml
│ │ │ │ └── ServiceStubs.xml
│ │ │ ├── Gateways
│ │ │ │ ├── IMarketDataService.cs
│ │ │ │ └── MarketDataServiceGateway.cs
│ │ │ ├── Handlers
│ │ │ │ ├── LoggingExceptionListener.cs
│ │ │ │ └── StockAppHandler.cs
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Services
│ │ │ │ ├── ICreditCheckService.cs
│ │ │ │ ├── IExecutionVenueService.cs
│ │ │ │ ├── ITradingService.cs
│ │ │ │ └── Stubs
│ │ │ │ ├── CreditCheckServiceStub.cs
│ │ │ │ ├── ExecutionVenueServiceStub.cs
│ │ │ │ └── TradingServiceStub.cs
│ │ │ ├── Spring.NmsQuickStart.Server.2008.csproj
│ │ │ ├── Spring.NmsQuickStart.Server.2010.csproj
│ │ │ └── Spring.NmsQuickStart.Server.csproj
│ │ └── test
│ │ └── Spring
│ │ ├── Spring.NmsQuickStart.Integration.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Spring.NmsQuickStart.Integration.Tests.2005.csproj
│ │ │ ├── Spring.NmsQuickStart.Integration.Tests.2008.csproj
│ │ │ └── Spring.NmsQuickStart.Integration.Tests.2010.csproj
│ │ └── Spring.NmsQuickStart.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.NmsQuickStart.Tests.2005.csproj
│ │ ├── Spring.NmsQuickStart.Tests.2008.csproj
│ │ └── Spring.NmsQuickStart.Tests.2010.csproj
│ ├── Spring.Scheduling.Quartz.Example
│ │ ├── Spring.Scheduling.Quartz.Example.2003.sln
│ │ ├── Spring.Scheduling.Quartz.Example.2005.sln
│ │ ├── Spring.Scheduling.Quartz.Example.2008.sln
│ │ ├── Spring.Scheduling.Quartz.Example.2010.sln
│ │ ├── Spring.Scheduling.Quartz.Example.build
│ │ ├── src
│ │ │ ├── AdminService.cs
│ │ │ ├── App.config
│ │ │ ├── ExampleJob.cs
│ │ │ ├── Program.cs
│ │ │ ├── spring-objects.xml
│ │ │ ├── Spring.Scheduling.Quartz.Example.2003.csproj
│ │ │ ├── Spring.Scheduling.Quartz.Example.2005.csproj
│ │ │ ├── Spring.Scheduling.Quartz.Example.2008.csproj
│ │ │ ├── Spring.Scheduling.Quartz.Example.2010.csproj
│ │ │ └── Spring.Scheduling.Quartz.Example.xml
│ │ ├── UpgradeLog.XML
│ │ └── _UpgradeReport_Files
│ │ ├── UpgradeReport.css
│ │ ├── UpgradeReport_Minus.gif
│ │ ├── UpgradeReport_Plus.gif
│ │ └── UpgradeReport.xslt
│ ├── Spring.TxQuickStart
│ │ ├── Spring.TxQuickStart.2003.sln
│ │ ├── Spring.TxQuickStart.2005.sln
│ │ ├── Spring.TxQuickStart.2008.sln
│ │ ├── Spring.TxQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── CommonAssemblyInfo.cs
│ │ │ └── Spring.TxQuickStart
│ │ │ ├── Spring.TxQuickStart.2003.csproj
│ │ │ ├── Spring.TxQuickStart.2005.csproj
│ │ │ ├── Spring.TxQuickStart.2008.csproj
│ │ │ ├── Spring.TxQuickStart.2010.csproj
│ │ │ ├── Spring.TxQuickStart.xml
│ │ │ └── TxQuickStart
│ │ │ ├── application-config.xml
│ │ │ ├── CreditsDebitsSchema.sql
│ │ │ ├── Dao
│ │ │ │ ├── Ado
│ │ │ │ │ ├── AccountCreditDao.cs
│ │ │ │ │ └── AccountDebitDao.cs
│ │ │ │ ├── IAccountCreditDao.cs
│ │ │ │ └── IAccountDebitDao.cs
│ │ │ └── Services
│ │ │ ├── AccountManager.cs
│ │ │ └── IAccountManager.cs
│ │ ├── test
│ │ │ └── Spring
│ │ │ └── Spring.TxQuickStart.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Spring.TxQuickStart.Tests.2003.csproj
│ │ │ ├── Spring.TxQuickStart.Tests.2005.csproj
│ │ │ ├── Spring.TxQuickStart.Tests.2008.csproj
│ │ │ ├── Spring.TxQuickStart.Tests.2010.csproj
│ │ │ ├── Spring.TxQuickStart.Tests.build
│ │ │ ├── Spring.TxQuickStart.Tests.dll.config
│ │ │ └── TxQuickStart
│ │ │ ├── AccountManagerTests.cs
│ │ │ ├── aspects-config.xml
│ │ │ ├── Services
│ │ │ │ ├── AccountManagerUnitTests.cs
│ │ │ │ ├── StubAccountCreditDao.cs
│ │ │ │ └── StubAccountDebitDao.cs
│ │ │ ├── system-test-dtc-config.xml
│ │ │ ├── system-test-dtc-es-config.xml
│ │ │ └── system-test-local-config.xml
│ │ ├── UpgradeLog.XML
│ │ └── _UpgradeReport_Files
│ │ ├── UpgradeReport.css
│ │ ├── UpgradeReport_Minus.gif
│ │ ├── UpgradeReport_Plus.gif
│ │ └── UpgradeReport.xslt
│ ├── Spring.WcfQuickStart
│ │ ├── Spring.WcfQuickStart.2008.sln
│ │ ├── Spring.WcfQuickStart.2010.sln
│ │ └── src
│ │ ├── Spring.WcfQuickStart.Aspects
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── SimplePerformanceInterceptor.cs
│ │ │ ├── Spring.WcfQuickStart.Aspects.2010.csproj
│ │ │ └── Spring.WcfQuickStart.Aspects.csproj
│ │ ├── Spring.WcfQuickStart.ClientApp
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── Aspects.xml
│ │ │ │ ├── ServerApp.xml
│ │ │ │ └── ServerWeb.xml
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.WcfQuickStart.ClientApp.2008.csproj
│ │ │ └── Spring.WcfQuickStart.ClientApp.2010.csproj
│ │ ├── Spring.WcfQuickStart.Contracts
│ │ │ ├── AbstractCalculatorService.cs
│ │ │ ├── ICalculator.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.WcfQuickStart.Contracts.2010.csproj
│ │ │ └── Spring.WcfQuickStart.Contracts.csproj
│ │ ├── Spring.WcfQuickStart.ServerApp
│ │ │ ├── App.config
│ │ │ ├── CalculatorService.cs
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.WcfQuickStart.ServerApp.2008.csproj
│ │ │ └── Spring.WcfQuickStart.ServerApp.2010.csproj
│ │ └── Spring.WcfQuickStart.ServerWeb
│ │ ├── CalculatorService.cs
│ │ ├── Calculator.svc
│ │ ├── Properties
│ │ │ └── AssemblyInfo.cs
│ │ ├── Spring.WcfQuickStart.ServerWeb.2008.csproj
│ │ ├── Spring.WcfQuickStart.ServerWeb.2010.csproj
│ │ └── Web.config
│ ├── Spring.Web.Extensions.Example
│ │ ├── Spring.Web.Extensions.Example.2005.sln
│ │ ├── Spring.Web.Extensions.Example.2008.sln
│ │ ├── Spring.Web.Extensions.Example.2010.sln
│ │ └── src
│ │ ├── Spring.Web.Extensions.Example.2005
│ │ │ ├── App_Code
│ │ │ │ ├── ContactService.cs
│ │ │ │ ├── IContactService.cs
│ │ │ │ └── StringArrayFilterAdvice.cs
│ │ │ ├── Bin
│ │ │ │ ├── Common.Logging.dll.refresh
│ │ │ │ ├── Spring.Aop.dll.refresh
│ │ │ │ ├── Spring.Core.dll.refresh
│ │ │ │ ├── Spring.Web.dll.refresh
│ │ │ │ ├── Spring.Web.Extensions.dll.refresh
│ │ │ │ └── System.Web.Extensions.dll.refresh
│ │ │ ├── ContactWebServiceMethods.js
│ │ │ ├── Default.aspx
│ │ │ ├── Spring.config
│ │ │ └── Web.config
│ │ ├── Spring.Web.Extensions.Example.2008
│ │ │ ├── App_Code
│ │ │ │ ├── ContactService.cs
│ │ │ │ ├── IContactService.cs
│ │ │ │ └── StringArrayFilterAdvice.cs
│ │ │ ├── Bin
│ │ │ │ ├── Common.Logging.dll.refresh
│ │ │ │ ├── Spring.Aop.dll.refresh
│ │ │ │ ├── Spring.Core.dll.refresh
│ │ │ │ ├── Spring.Web.dll.refresh
│ │ │ │ └── Spring.Web.Extensions.dll.refresh
│ │ │ ├── ContactWebServiceMethods.js
│ │ │ ├── Default.aspx
│ │ │ ├── Spring.config
│ │ │ └── Web.config
│ │ └── Spring.Web.Extensions.Example.2010
│ │ ├── App_Code
│ │ │ ├── ContactService.cs
│ │ │ ├── IContactService.cs
│ │ │ └── StringArrayFilterAdvice.cs
│ │ ├── Bin
│ │ │ ├── Common.Logging.dll.refresh
│ │ │ ├── Spring.Aop.dll.refresh
│ │ │ ├── Spring.Core.dll.refresh
│ │ │ ├── Spring.Web.dll.refresh
│ │ │ └── Spring.Web.Extensions.dll.refresh
│ │ ├── ContactWebServiceMethods.js
│ │ ├── Default.aspx
│ │ ├── Spring.config
│ │ └── Web.config
│ └── Spring.WebQuickStart
│ ├── Spring.WebQuickStart.2005.sln
│ ├── Spring.WebQuickStart.2008.sln
│ ├── Spring.WebQuickStart.2010.sln
│ ├── src
│ │ ├── Spring.WebQuickStart.2005
│ │ │ ├── App_Code
│ │ │ │ ├── EmployeeInfo.cs
│ │ │ │ ├── HtmlCommentAppenderModule.cs
│ │ │ │ ├── MyCustomHttpHandler.cs
│ │ │ │ └── ProductInfo.cs
│ │ │ ├── DataBinding
│ │ │ │ ├── Collections
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ ├── EasyEmployeeInfo
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.cs
│ │ │ │ │ └── Web.Config
│ │ │ │ ├── EmployeeInfo
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── EventHandling
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── HelloWorld
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── Lists
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── NestedEmployeeInfo
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.cs
│ │ │ │ │ ├── EmployeeInfoEditor.ascx
│ │ │ │ │ └── EmployeeInfoEditor.ascx.cs
│ │ │ │ └── RobustEmployeeInfo
│ │ │ │ ├── Default.aspx
│ │ │ │ └── Default.aspx.cs
│ │ │ ├── Default.aspx
│ │ │ ├── Default.aspx.cs
│ │ │ ├── DI
│ │ │ │ ├── CustomHandlers
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.bak
│ │ │ │ │ ├── DemoHandler.ashx
│ │ │ │ │ └── web.config
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ ├── HelloWorld
│ │ │ │ │ ├── CustomControl.ascx
│ │ │ │ │ ├── CustomControl.ascx.cs
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.cs
│ │ │ │ │ ├── Splashpage.aspx
│ │ │ │ │ └── Web.config
│ │ │ │ └── NestedContexts
│ │ │ │ ├── ContextA
│ │ │ │ │ ├── CustomControl.ascx
│ │ │ │ │ └── CustomControl.ascx.cs
│ │ │ │ ├── ContextB
│ │ │ │ │ ├── CustomControl.ascx
│ │ │ │ │ ├── CustomControl.ascx.cs
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.cs
│ │ │ │ │ └── Web.config
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ └── Web.config
│ │ │ ├── Navigation
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ ├── InvalidInput.aspx
│ │ │ │ ├── InvalidInput.aspx.cs
│ │ │ │ ├── Master.master
│ │ │ │ ├── Master.master.cs
│ │ │ │ ├── Ok.aspx
│ │ │ │ ├── Ok.aspx.cs
│ │ │ │ └── Web.config
│ │ │ ├── Web.Config
│ │ │ └── web_mediumtrust.config
│ │ └── Spring.WebQuickStart.Providers
│ │ ├── App_Code
│ │ │ └── TextFileWebEventProvider.cs
│ │ ├── App_Data
│ │ │ ├── aspnetdb_log.ldf
│ │ │ └── ASPNETDB.MDF
│ │ ├── Config
│ │ │ └── Web.xml
│ │ ├── Default.aspx
│ │ ├── Default.aspx.cs
│ │ ├── Global.asax
│ │ ├── SitemapTest.aspx
│ │ ├── SitemapTest.aspx.cs
│ │ ├── TestProviders
│ │ │ ├── MembershipTest.aspx
│ │ │ ├── MembershipTest.aspx.cs
│ │ │ ├── ProfileTest.aspx
│ │ │ ├── ProfileTest.aspx.cs
│ │ │ ├── RolesTest.aspx
│ │ │ ├── RolesTest.aspx.cs
│ │ │ └── Web.config
│ │ ├── UserLogin.aspx
│ │ ├── UserLogin.aspx.cs
│ │ ├── Web.config
│ │ └── Web.sitemap
│ ├── test
│ └── test.integration
├── lib
│ ├── Net
│ │ ├── 1.0
│ │ │ ├── Common.Logging.dll
│ │ │ ├── DotNetMock.dll
│ │ │ ├── DotNetMock.Framework.dll
│ │ │ ├── nunit.framework.dll
│ │ │ └── Rhino.Mocks.dll
│ │ ├── 1.1
│ │ │ ├── Common.Logging.dll
│ │ │ ├── DotNetMock.dll
│ │ │ ├── DotNetMock.Framework.dll
│ │ │ ├── Nullables.dll
│ │ │ ├── NUnitAsp.dll
│ │ │ ├── NUnitAspEx.dll
│ │ │ ├── nunit.core.dll
│ │ │ ├── nunit.core.interfaces.dll
│ │ │ ├── nunit.framework.dll
│ │ │ ├── nunit.framework.xml
│ │ │ ├── Quartz.dll
│ │ │ └── Rhino.Mocks.dll
│ │ ├── 2.0
│ │ │ ├── Apache.NMS.ActiveMQ.dll
│ │ │ ├── Apache.NMS.ActiveMQ.pdb
│ │ │ ├── Apache.NMS.dll
│ │ │ ├── Apache.NMS.pdb
│ │ │ ├── Common.Logging.dll
│ │ │ ├── DotNetMock.dll
│ │ │ ├── DotNetMock.Framework.dll
│ │ │ ├── EULA.rtf
│ │ │ ├── NUnitAsp.dll
│ │ │ ├── NUnitAspEx.dll
│ │ │ ├── nunit.core.dll
│ │ │ ├── nunit.core.interfaces.dll
│ │ │ ├── nunit.framework.dll
│ │ │ ├── nunit.framework.xml
│ │ │ ├── NVelocity.dll
│ │ │ ├── NVelocity.pdb
│ │ │ ├── Quartz.dll
│ │ │ └── Rhino.Mocks.dll
│ │ ├── 3.5
│ │ │ ├── Apache.NMS.ActiveMQ.dll
│ │ │ ├── Apache.NMS.dll
│ │ │ ├── Common.Logging.dll
│ │ │ ├── DotNetMock.dll
│ │ │ ├── DotNetMock.Framework.dll
│ │ │ ├── NUnitAsp.dll
│ │ │ ├── NUnitAspEx.dll
│ │ │ ├── nunit.core.dll
│ │ │ ├── nunit.core.interfaces.dll
│ │ │ ├── nunit.framework.dll
│ │ │ ├── nunit.framework.xml
│ │ │ ├── NVelocity.dll
│ │ │ ├── Quartz.dll
│ │ │ └── Rhino.Mocks.dll
│ │ └── 4.0
│ │ ├── Apache.NMS.ActiveMQ.dll
│ │ ├── Apache.NMS.dll
│ │ ├── Common.Logging.dll
│ │ ├── DotNetMock.dll
│ │ ├── DotNetMock.Framework.dll
│ │ ├── NUnitAsp.dll
│ │ ├── NUnitAspEx.dll
│ │ ├── nunit.core.dll
│ │ ├── nunit.core.interfaces.dll
│ │ ├── nunit.framework.dll
│ │ ├── nunit.framework.xml
│ │ ├── NVelocity.dll
│ │ ├── Quartz.dll
│ │ └── Rhino.Mocks.dll
│ ├── NHibernate12
│ │ └── net
│ │ ├── 1.1
│ │ │ ├── Castle.DynamicProxy.dll
│ │ │ ├── Castle.DynamicProxy.xml
│ │ │ ├── HashCodeProvider.dll
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.xml
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.xml
│ │ │ ├── NHibernate.dll
│ │ │ └── NHibernate.xml
│ │ ├── 2.0
│ │ │ ├── Castle.DynamicProxy.dll
│ │ │ ├── Castle.DynamicProxy.license.txt
│ │ │ ├── Castle.DynamicProxy.xml
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── Iesi.Collections.xml
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.xml
│ │ │ ├── NHibernate.dll
│ │ │ ├── NHibernate.license.txt
│ │ │ └── NHibernate.xml
│ │ └── 4.0
│ │ ├── Castle.DynamicProxy.dll
│ │ ├── Castle.DynamicProxy.license.txt
│ │ ├── Castle.DynamicProxy.xml
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── Iesi.Collections.xml
│ │ ├── log4net.dll
│ │ ├── log4net.xml
│ │ ├── NHibernate.dll
│ │ ├── NHibernate.license.txt
│ │ └── NHibernate.xml
│ ├── NHibernate20
│ │ └── net
│ │ ├── 2.0
│ │ │ ├── Castle.Core.dll
│ │ │ ├── Castle.Core.xml
│ │ │ ├── Castle.DynamicProxy2.dll
│ │ │ ├── Castle.DynamicProxy2.xml
│ │ │ ├── Castle.DynamicProxy.license.txt
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── Iesi.Collections.xml
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.license.txt
│ │ │ ├── log4net.xml
│ │ │ ├── NHibernate.dll
│ │ │ ├── NHibernate.license.txt
│ │ │ └── NHibernate.xml
│ │ └── 4.0
│ │ ├── Castle.Core.dll
│ │ ├── Castle.Core.xml
│ │ ├── Castle.DynamicProxy2.dll
│ │ ├── Castle.DynamicProxy2.xml
│ │ ├── Castle.DynamicProxy.license.txt
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── Iesi.Collections.xml
│ │ ├── log4net.dll
│ │ ├── log4net.license.txt
│ │ ├── log4net.xml
│ │ ├── NHibernate.dll
│ │ ├── NHibernate.license.txt
│ │ └── NHibernate.xml
│ ├── NHibernate21
│ │ └── net
│ │ ├── 2.0
│ │ │ ├── Antlr3.Runtime.dll
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── Iesi.Collections.xml
│ │ │ ├── LinFu.DynamicProxy.dll
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.license.txt
│ │ │ ├── log4net.xml
│ │ │ ├── NHibernate.dll
│ │ │ ├── NHibernate.DomainModel.dll
│ │ │ ├── NHibernate.license.txt
│ │ │ ├── NHibernate.Test.dll
│ │ │ └── NHibernate.xml
│ │ └── 4.0
│ │ ├── Antlr3.Runtime.dll
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── Iesi.Collections.xml
│ │ ├── LinFu.DynamicProxy.dll
│ │ ├── log4net.dll
│ │ ├── log4net.license.txt
│ │ ├── log4net.xml
│ │ ├── NHibernate.dll
│ │ ├── NHibernate.DomainModel.dll
│ │ ├── NHibernate.license.txt
│ │ ├── NHibernate.Test.dll
│ │ └── NHibernate.xml
│ ├── NHibernate30
│ │ └── net
│ │ ├── 3.5
│ │ │ ├── Antlr3.Runtime.dll
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.license.txt
│ │ │ ├── NHibernate.dll
│ │ │ ├── NHibernate.license.txt
│ │ │ └── Remotion.Data.Linq.dll
│ │ └── 4.0
│ │ ├── Antlr3.Runtime.dll
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── log4net.dll
│ │ ├── log4net.license.txt
│ │ ├── NHibernate.dll
│ │ ├── NHibernate.license.txt
│ │ └── Remotion.Data.Linq.dll
│ ├── NHibernate31
│ │ └── net
│ │ ├── 3.5
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── NHibernate.dll
│ │ │ └── NHibernate.license.txt
│ │ └── 4.0
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── NHibernate.dll
│ │ └── NHibernate.license.txt
│ └── NHibernate32
│ └── net
│ ├── 3.5
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── NHibernate.dll
│ │ └── NHibernate.license.txt
│ └── 4.0
│ ├── Iesi.Collections.dll
│ ├── Iesi.Collections.license.txt
│ ├── NHibernate.dll
│ └── NHibernate.license.txt
├── license.txt
├── readme.txt
├── Spring.build
├── Spring.include
├── Spring.Net.2003.sln
├── Spring.Net.2005.sln
├── Spring.Net.2008.sln
├── Spring.Net.2010.sln
├── src
│ └── Spring
│ ├── CommonAssemblyInfo.cs
│ ├── Spring.Aop
│ │ ├── Aop
│ │ │ ├── Config
│ │ │ │ ├── AopNamespaceParser.cs
│ │ │ │ ├── AopNamespaceUtils.cs
│ │ │ │ ├── ConfigObjectDefinitionParser.cs
│ │ │ │ ├── spring-aop-1.1.xsd
│ │ │ │ └── spring-aop-1.1.xsx
│ │ │ ├── Framework
│ │ │ │ ├── AbstractMethodInvocation.cs
│ │ │ │ ├── Adapter
│ │ │ │ │ ├── AdvisorAdapterRegistrationManager.cs
│ │ │ │ │ ├── AfterReturningAdviceAdapter.cs
│ │ │ │ │ ├── AfterReturningAdviceInterceptor.cs
│ │ │ │ │ ├── BeforeAdviceAdapter.cs
│ │ │ │ │ ├── DefaultAdvisorAdapterRegistry.cs
│ │ │ │ │ ├── GlobalAdvisorAdapterRegistry.cs
│ │ │ │ │ ├── IAdvisorAdapter.cs
│ │ │ │ │ ├── IAdvisorAdapterRegistry.cs
│ │ │ │ │ ├── MethodBeforeAdviceInterceptor.cs
│ │ │ │ │ ├── ThrowsAdviceAdapter.cs
│ │ │ │ │ ├── ThrowsAdviceInterceptor.cs
│ │ │ │ │ └── UnknownAdviceTypeException.cs
│ │ │ │ ├── AdvisedSupport.cs
│ │ │ │ ├── AdvisorChainFactoryUtils.cs
│ │ │ │ ├── AopConfigException.cs
│ │ │ │ ├── AopContext.cs
│ │ │ │ ├── AopUtils.cs
│ │ │ │ ├── AutoProxy
│ │ │ │ │ ├── AbstractAdvisorAutoProxyCreator.cs
│ │ │ │ │ ├── AbstractAutoProxyCreator.cs
│ │ │ │ │ ├── AbstractFilteringAutoProxyCreator.cs
│ │ │ │ │ ├── AttributeAutoProxyCreator.cs
│ │ │ │ │ ├── DefaultAdvisorAutoProxyCreator.cs
│ │ │ │ │ ├── IAdvisorRetrievalHelper.cs
│ │ │ │ │ ├── InfrastructureAdvisorAutoProxyCreator.cs
│ │ │ │ │ ├── InheritanceBasedAopConfigurer.cs
│ │ │ │ │ ├── ITargetSourceCreator.cs
│ │ │ │ │ ├── ObjectFactoryAdvisorRetrievalHelper.cs
│ │ │ │ │ ├── ObjectNameAutoProxyCreator.cs
│ │ │ │ │ ├── PointcutFilteringAutoProxyCreator.cs
│ │ │ │ │ ├── Target
│ │ │ │ │ │ └── AbstractPrototypeTargetSourceCreator.cs
│ │ │ │ │ └── TypeNameAutoProxyCreator.cs
│ │ │ │ ├── DynamicMethodInvocation.cs
│ │ │ │ ├── DynamicProxy
│ │ │ │ │ ├── AbstractAopProxyFactory.cs
│ │ │ │ │ ├── AbstractAopProxyMethodBuilder.cs
│ │ │ │ │ ├── AbstractAopProxyTypeBuilder.cs
│ │ │ │ │ ├── AdvisedProxy.cs
│ │ │ │ │ ├── BaseAopProxyMethodBuilder.cs
│ │ │ │ │ ├── BaseCompositionAopProxy.cs
│ │ │ │ │ ├── CachedAopProxyFactory.cs
│ │ │ │ │ ├── CompositionAopProxyTypeBuilder.cs
│ │ │ │ │ ├── DecoratorAopProxyTypeBuilder.cs
│ │ │ │ │ ├── DefaultAopProxyFactory.cs
│ │ │ │ │ ├── IAdvisedProxyMethodBuilder.cs
│ │ │ │ │ ├── IAopProxyTypeGenerator.cs
│ │ │ │ │ ├── InheritanceAopProxyTypeBuilder.cs
│ │ │ │ │ ├── IntroductionProxyMethodBuilder.cs
│ │ │ │ │ └── TargetAopProxyMethodBuilder.cs
│ │ │ │ ├── HashtableCachingAdvisorChainFactory.cs
│ │ │ │ ├── IAdvised.cs
│ │ │ │ ├── IAdvisedSupportListener.cs
│ │ │ │ ├── IAdvisorChainFactory.cs
│ │ │ │ ├── IAopProxy.cs
│ │ │ │ ├── IAopProxyFactory.cs
│ │ │ │ ├── InterceptorAndDynamicMethodMatcher.cs
│ │ │ │ ├── ITargetAware.cs
│ │ │ │ ├── ProxyConfig.cs
│ │ │ │ ├── ProxyFactory.cs
│ │ │ │ ├── ProxyFactoryObject.cs
│ │ │ │ └── ReflectiveMethodInvocation.cs
│ │ │ ├── IAdvisor.cs
│ │ │ ├── IAdvisors.cs
│ │ │ ├── IAfterReturningAdvice.cs
│ │ │ ├── IBeforeAdvice.cs
│ │ │ ├── IIntroductionAdvisor.cs
│ │ │ ├── IIntroductionInterceptor.cs
│ │ │ ├── IMethodBeforeAdvice.cs
│ │ │ ├── IMethodMatcher.cs
│ │ │ ├── IPointcutAdvisor.cs
│ │ │ ├── IPointcut.cs
│ │ │ ├── ITargetSource.cs
│ │ │ ├── IThrowsAdvice.cs
│ │ │ ├── ITypeFilter.cs
│ │ │ ├── Support
│ │ │ │ ├── AbstractGenericPointcutAdvisor.cs
│ │ │ │ ├── AbstractObjectFactoryPointcutAdvisor.cs
│ │ │ │ ├── AbstractPointcutAdvisor.cs
│ │ │ │ ├── AbstractRegularExpressionMethodPointcut.cs
│ │ │ │ ├── AttributeMatchingPointcut.cs
│ │ │ │ ├── AttributeMatchMethodPointcutAdvisor.cs
│ │ │ │ ├── AttributeMatchMethodPointcut.cs
│ │ │ │ ├── AttributeMethodMatcher.cs
│ │ │ │ ├── AttributeTypeFilter.cs
│ │ │ │ ├── ComposablePointcut.cs
│ │ │ │ ├── ControlFlowPointcut.cs
│ │ │ │ ├── DefaultIntroductionAdvisor.cs
│ │ │ │ ├── DefaultObjectFactoryPointcutAdvisor.cs
│ │ │ │ ├── DefaultPointcutAdvisor.cs
│ │ │ │ ├── DynamicMethodMatcher.cs
│ │ │ │ ├── DynamicMethodMatcherPointcutAdvisor.cs
│ │ │ │ ├── MethodMatchers.cs
│ │ │ │ ├── NameMatchMethodPointcutAdvisor.cs
│ │ │ │ ├── NameMatchMethodPointcut.cs
│ │ │ │ ├── Pointcuts.cs
│ │ │ │ ├── RegularExpressionMethodPointcutAdvisor.cs
│ │ │ │ ├── RootTypeFilter.cs
│ │ │ │ ├── SdkRegularExpressionMethodPointcut.cs
│ │ │ │ ├── StaticMethodMatcher.cs
│ │ │ │ ├── StaticMethodMatcherPointcutAdvisor.cs
│ │ │ │ ├── StaticMethodMatcherPointcut.cs
│ │ │ │ ├── TypeFilters.cs
│ │ │ │ ├── TypeNameTypeFilter.cs
│ │ │ │ └── UnionPointcut.cs
│ │ │ ├── Target
│ │ │ │ ├── AbstractPoolingTargetSource.cs
│ │ │ │ ├── AbstractPrototypeTargetSource.cs
│ │ │ │ ├── EmptyTargetSource.cs
│ │ │ │ ├── HotSwappableTargetSource.cs
│ │ │ │ ├── IThreadLocalTargetSourceStats.cs
│ │ │ │ ├── PoolingConfig.cs
│ │ │ │ ├── PrototypeTargetSource.cs
│ │ │ │ ├── SimplePoolTargetSource.cs
│ │ │ │ ├── SingletonTargetSource.cs
│ │ │ │ └── ThreadLocalTargetSource.cs
│ │ │ ├── TrueMethodMatcher.cs
│ │ │ ├── TruePointcut.cs
│ │ │ └── TrueTypeFilter.cs
│ │ ├── AopAlliance
│ │ │ ├── Aop
│ │ │ │ ├── AspectException.cs
│ │ │ │ └── IAdvice.cs
│ │ │ └── Intercept
│ │ │ ├── IConstructorInterceptor.cs
│ │ │ ├── IConstructorInvocation.cs
│ │ │ ├── IInterceptor.cs
│ │ │ ├── IInvocation.cs
│ │ │ ├── IJoinpoint.cs
│ │ │ ├── IMethodInterceptor.cs
│ │ │ └── IMethodInvocation.cs
│ │ ├── Aspects
│ │ │ ├── AbstractExceptionHandlerAdvice.cs
│ │ │ ├── AbstractExceptionHandler.cs
│ │ │ ├── Cache
│ │ │ │ ├── BaseCacheAdvice.cs
│ │ │ │ ├── CacheAspect.cs
│ │ │ │ ├── CacheParameterAdvice.cs
│ │ │ │ ├── CacheParameterAdvisor.cs
│ │ │ │ ├── CacheResultAdvice.cs
│ │ │ │ ├── CacheResultAdvisor.cs
│ │ │ │ ├── InvalidateCacheAdvice.cs
│ │ │ │ └── InvalidateCacheAdvisor.cs
│ │ │ ├── Exceptions
│ │ │ │ ├── ExceptionHandlerAdvice.cs
│ │ │ │ ├── ExecuteSpelExceptionHandler.cs
│ │ │ │ ├── LogExceptionHandler.cs
│ │ │ │ ├── ReturnValueExceptionHandler.cs
│ │ │ │ ├── SwallowExceptionHandler.cs
│ │ │ │ └── TranslationExceptionHandler.cs
│ │ │ ├── IExceptionHandler.cs
│ │ │ ├── Logging
│ │ │ │ ├── AbstractLoggingAdvice.cs
│ │ │ │ └── SimpleLoggingAdvice.cs
│ │ │ ├── ParsedAdviceExpression.cs
│ │ │ ├── RetryAdvice.cs
│ │ │ ├── RetryExceptionHandler.cs
│ │ │ └── Validation
│ │ │ ├── ParameterValidationAdvice.cs
│ │ │ └── ParameterValidationAdvisor.cs
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.Aop.2002.csproj
│ │ ├── Spring.Aop.2003.csproj
│ │ ├── Spring.Aop.2005.csproj
│ │ ├── Spring.Aop.2008.csproj
│ │ ├── Spring.Aop.2010.csproj
│ │ ├── Spring.Aop.build
│ │ ├── Spring.Aop.nuspec
│ │ └── Spring.Aop.xml
│ ├── Spring.Core
│ │ ├── AssemblyInfo.cs
│ │ ├── Caching
│ │ │ ├── AbstractCache.cs
│ │ │ ├── BaseCacheAttribute.cs
│ │ │ ├── CacheParameterAttribute.cs
│ │ │ ├── CacheResultAttribute.cs
│ │ │ ├── CacheResultItemsAttribute.cs
│ │ │ ├── ICache.cs
│ │ │ ├── InvalidateCacheAttribute.cs
│ │ │ └── NonExpiringCache.cs
│ │ ├── Collections
│ │ │ ├── AbstractQueue.cs
│ │ │ ├── CaseInsensitiveHashtable.cs
│ │ │ ├── DictionarySet.cs
│ │ │ ├── Generic
│ │ │ │ ├── DictionarySet.cs
│ │ │ │ ├── HashedSet.cs
│ │ │ │ ├── ImmutableSet.cs
│ │ │ │ ├── ISet.cs
│ │ │ │ ├── OrderedSet.cs
│ │ │ │ ├── ReadOnlyDictionary.cs
│ │ │ │ ├── Set.cs
│ │ │ │ ├── SortedSet.cs
│ │ │ │ └── SynchronizedSet.cs
│ │ │ ├── HashedSet.cs
│ │ │ ├── HybridSet.cs
│ │ │ ├── ImmutableSet.cs
│ │ │ ├── IQueue.cs
│ │ │ ├── ISet.cs
│ │ │ ├── LinkedList.cs
│ │ │ ├── ListSet.cs
│ │ │ ├── NoElementsException.cs
│ │ │ ├── PriorityQueue.cs
│ │ │ ├── Set.cs
│ │ │ ├── SortedSet.cs
│ │ │ ├── SynchronizedDictionaryEnumerator.cs
│ │ │ ├── SynchronizedEnumerator.cs
│ │ │ ├── SynchronizedHashtable.cs
│ │ │ └── SynchronizedSet.cs
│ │ ├── Context
│ │ │ ├── ApplicationContextException.cs
│ │ │ ├── ApplicationEventArgs.cs
│ │ │ ├── EventListenerAttribute.cs
│ │ │ ├── Events
│ │ │ │ ├── ConsoleListener.cs
│ │ │ │ └── ContextEventArgs.cs
│ │ │ ├── IApplicationContextAware.cs
│ │ │ ├── IApplicationContext.cs
│ │ │ ├── IApplicationEventListener.cs
│ │ │ ├── IApplicationEventPublisher.cs
│ │ │ ├── IConfigurableApplicationContext.cs
│ │ │ ├── IHierarchicalMessageSource.cs
│ │ │ ├── ILifecycle.cs
│ │ │ ├── IMessageSourceAware.cs
│ │ │ ├── IMessageSource.cs
│ │ │ ├── IMessageSourceResolvable.cs
│ │ │ ├── IResourceLoaderAware.cs
│ │ │ ├── NoSuchMessageException.cs
│ │ │ └── Support
│ │ │ ├── AbstractApplicationContext.cs
│ │ │ ├── AbstractMessageSource.cs
│ │ │ ├── AbstractXmlApplicationContextArgs.cs
│ │ │ ├── AbstractXmlApplicationContext.cs
│ │ │ ├── ApplicationContextAwareProcessor.cs
│ │ │ ├── ApplicationObjectSupport.cs
│ │ │ ├── ContextHandler.cs
│ │ │ ├── ContextRegistry.cs
│ │ │ ├── DefaultMessageSourceResolvable.cs
│ │ │ ├── DefaultSectionHandler.cs
│ │ │ ├── DelegatingMessageSource.cs
│ │ │ ├── GenericApplicationContext.cs
│ │ │ ├── MessageSourceAccessor.cs
│ │ │ ├── MessageSourceResolvableVisitor.cs
│ │ │ ├── NamespaceParsersSectionHandler.cs
│ │ │ ├── NullMessageSource.cs
│ │ │ ├── ResourceHandlersSectionHandler.cs
│ │ │ ├── ResourceSetMessageSource.cs
│ │ │ ├── StaticApplicationContext.cs
│ │ │ ├── StaticMessageSource.cs
│ │ │ ├── TypeAliasesSectionHandler.cs
│ │ │ ├── TypeConvertersSectionHandler.cs
│ │ │ ├── XmlApplicationContextArgs.cs
│ │ │ └── XmlApplicationContext.cs
│ │ ├── ContextClassDiagram.cd
│ │ ├── Core
│ │ │ ├── CannotLoadObjectTypeException.cs
│ │ │ ├── ComposedCriteria.cs
│ │ │ ├── ControlFlowFactory.cs
│ │ │ ├── Conventions.cs
│ │ │ ├── CriteriaMemberFilter.cs
│ │ │ ├── IControlFlow.cs
│ │ │ ├── ICriteria.cs
│ │ │ ├── IErrorCoded.cs
│ │ │ ├── InvalidPropertyException.cs
│ │ │ ├── IO
│ │ │ │ ├── AbstractResource.cs
│ │ │ │ ├── AssemblyResource.cs
│ │ │ │ ├── ConfigSectionResource.cs
│ │ │ │ ├── ConfigurableResourceLoader.cs
│ │ │ │ ├── EncodedResource.cs
│ │ │ │ ├── FileSystemResource.cs
│ │ │ │ ├── IInputStreamSource.cs
│ │ │ │ ├── InputStreamResource.cs
│ │ │ │ ├── IResource.cs
│ │ │ │ ├── IResourceLoader.cs
│ │ │ │ ├── ResourceConverter.cs
│ │ │ │ ├── ResourceHandlerRegistry.cs
│ │ │ │ ├── StringResource.cs
│ │ │ │ └── UrlResource.cs
│ │ │ ├── IOrdered.cs
│ │ │ ├── IPriorityOrdered.cs
│ │ │ ├── MethodArgumentsCriteria.cs
│ │ │ ├── MethodGenericArgumentsCountCriteria.cs
│ │ │ ├── MethodInvocationException.cs
│ │ │ ├── MethodNameMatchCriteria.cs
│ │ │ ├── MethodParameter.cs
│ │ │ ├── MethodParametersCountCriteria.cs
│ │ │ ├── MethodParametersCriteria.cs
│ │ │ ├── MethodReturnTypeCriteria.cs
│ │ │ ├── NotReadablePropertyException.cs
│ │ │ ├── NotWritablePropertyException.cs
│ │ │ ├── NullValueInNestedPathException.cs
│ │ │ ├── OrderComparator.cs
│ │ │ ├── PropertyAccessException.cs
│ │ │ ├── PropertyChangeEventArgs.cs
│ │ │ ├── RegularExpressionCriteria.cs
│ │ │ ├── RegularExpressionEventNameCriteria.cs
│ │ │ ├── RegularExpressionMethodNameCriteria.cs
│ │ │ ├── TypeConversion
│ │ │ │ ├── CredentialConverter.cs
│ │ │ │ ├── CustomNumberConverter.cs
│ │ │ │ ├── FileInfoConverter.cs
│ │ │ │ ├── NameValueConverter.cs
│ │ │ │ ├── RegexConverter.cs
│ │ │ │ ├── RegistryKeyConverter.cs
│ │ │ │ ├── ResourceManagerConverter.cs
│ │ │ │ ├── RGBColorConverter.cs
│ │ │ │ ├── RuntimeTypeConverter.cs
│ │ │ │ ├── StreamConverter.cs
│ │ │ │ ├── StringArrayConverter.cs
│ │ │ │ ├── TimeSpanConverter.cs
│ │ │ │ ├── TypeConversionUtils.cs
│ │ │ │ ├── TypeConverterRegistry.cs
│ │ │ │ ├── UniqueKeyConverter.cs
│ │ │ │ └── UriConverter.cs
│ │ │ ├── TypeMismatchException.cs
│ │ │ └── TypeResolution
│ │ │ ├── CachedTypeResolver.cs
│ │ │ ├── GenericArgumentsHolder.cs
│ │ │ ├── GenericTypeResolver.cs
│ │ │ ├── ITypeResolver.cs
│ │ │ ├── TypeAssemblyHolder.cs
│ │ │ ├── TypeRegistry.cs
│ │ │ ├── TypeResolutionUtils.cs
│ │ │ └── TypeResolver.cs
│ │ ├── DataBinding
│ │ │ ├── AbstractBinding.cs
│ │ │ ├── AbstractSimpleBinding.cs
│ │ │ ├── BaseBindingContainer.cs
│ │ │ ├── BaseBindingManager.cs
│ │ │ ├── BindingDirection.cs
│ │ │ ├── BindingErrorMessage.cs
│ │ │ ├── IBindingContainer.cs
│ │ │ ├── IBinding.cs
│ │ │ ├── IDataBound.cs
│ │ │ ├── ListBinding.cs
│ │ │ └── SimpleExpressionBinding.cs
│ │ ├── Expressions
│ │ │ ├── ArrayConstructorNode.cs
│ │ │ ├── AssignNode.cs
│ │ │ ├── AttributeNode.cs
│ │ │ ├── BaseNode.cs
│ │ │ ├── BinaryOperator.cs
│ │ │ ├── BooleanLiteralNode.cs
│ │ │ ├── ConstructorNode.cs
│ │ │ ├── DefaultNode.cs
│ │ │ ├── ExpressionConverter.cs
│ │ │ ├── Expression.cs
│ │ │ ├── ExpressionEvaluator.cs
│ │ │ ├── Expression.g
│ │ │ ├── ExpressionListNode.cs
│ │ │ ├── FunctionNode.cs
│ │ │ ├── HexLiteralNode.cs
│ │ │ ├── IExpression.cs
│ │ │ ├── IndexerNode.cs
│ │ │ ├── IntLiteralNode.cs
│ │ │ ├── LambdaExpressionNode.cs
│ │ │ ├── ListInitializerNode.cs
│ │ │ ├── LocalFunctionNode.cs
│ │ │ ├── LocalVariableNode.cs
│ │ │ ├── MapEntryNode.cs
│ │ │ ├── MapInitializerNode.cs
│ │ │ ├── MethodNode.cs
│ │ │ ├── NamedArgumentNode.cs
│ │ │ ├── NodeWithArguments.cs
│ │ │ ├── NullLiteralNode.cs
│ │ │ ├── OpADD.cs
│ │ │ ├── OpAND.cs
│ │ │ ├── OpBetween.cs
│ │ │ ├── OpDIVIDE.cs
│ │ │ ├── OpEqual.cs
│ │ │ ├── OpGreater.cs
│ │ │ ├── OpGreaterOrEqual.cs
│ │ │ ├── OpIn.cs
│ │ │ ├── OpIs.cs
│ │ │ ├── OpLess.cs
│ │ │ ├── OpLessOrEqual.cs
│ │ │ ├── OpLike.cs
│ │ │ ├── OpMatches.cs
│ │ │ ├── OpMODULUS.cs
│ │ │ ├── OpMULTIPLY.cs
│ │ │ ├── OpNOT.cs
│ │ │ ├── OpNotEqual.cs
│ │ │ ├── OpOR.cs
│ │ │ ├── OpPOWER.cs
│ │ │ ├── OpSUBTRACT.cs
│ │ │ ├── OpUnaryMinus.cs
│ │ │ ├── OpUnaryPlus.cs
│ │ │ ├── OpXOR.cs
│ │ │ ├── Parser
│ │ │ │ ├── antlr
│ │ │ │ │ ├── ANTLRException.cs
│ │ │ │ │ ├── ANTLRPanicException.cs
│ │ │ │ │ ├── ASTFactory.cs
│ │ │ │ │ ├── ASTNodeCreator.cs
│ │ │ │ │ ├── ASTNULLType.cs
│ │ │ │ │ ├── ASTPair.cs
│ │ │ │ │ ├── ASTVisitor.cs
│ │ │ │ │ ├── BaseAST.cs
│ │ │ │ │ ├── ByteBuffer.cs
│ │ │ │ │ ├── CharBuffer.cs
│ │ │ │ │ ├── CharQueue.cs
│ │ │ │ │ ├── CharScanner.cs
│ │ │ │ │ ├── CharStreamException.cs
│ │ │ │ │ ├── CharStreamIOException.cs
│ │ │ │ │ ├── collections
│ │ │ │ │ │ ├── AST.cs
│ │ │ │ │ │ └── impl
│ │ │ │ │ │ ├── ASTArray.cs
│ │ │ │ │ │ └── BitSet.cs
│ │ │ │ │ ├── CommonAST.cs
│ │ │ │ │ ├── CommonASTWithHiddenTokens.cs
│ │ │ │ │ ├── CommonHiddenStreamToken.cs
│ │ │ │ │ ├── CommonToken.cs
│ │ │ │ │ ├── debug
│ │ │ │ │ │ ├── ANTLREventArgs.cs
│ │ │ │ │ │ ├── DebuggingCharScanner.cs
│ │ │ │ │ │ ├── DebuggingInputBuffer.cs
│ │ │ │ │ │ ├── DebuggingParser.cs
│ │ │ │ │ │ ├── GuessingEventArgs.cs
│ │ │ │ │ │ ├── ICharScannerDebugSubject.cs
│ │ │ │ │ │ ├── IDebugSubject.cs
│ │ │ │ │ │ ├── InputBufferEventArgs.cs
│ │ │ │ │ │ ├── InputBufferEventSupport.cs
│ │ │ │ │ │ ├── InputBufferListenerBase.cs
│ │ │ │ │ │ ├── InputBufferListener.cs
│ │ │ │ │ │ ├── InputBufferReporter.cs
│ │ │ │ │ │ ├── IParserDebugSubject.cs
│ │ │ │ │ │ ├── Listener.cs
│ │ │ │ │ │ ├── LLkDebuggingParser.cs
│ │ │ │ │ │ ├── MessageEventArgs.cs
│ │ │ │ │ │ ├── MessageListenerBase.cs
│ │ │ │ │ │ ├── MessageListener.cs
│ │ │ │ │ │ ├── NewLineEventArgs.cs
│ │ │ │ │ │ ├── NewLineListener.cs
│ │ │ │ │ │ ├── ParserController.cs
│ │ │ │ │ │ ├── ParserEventSupport.cs
│ │ │ │ │ │ ├── ParserListenerBase.cs
│ │ │ │ │ │ ├── ParserListener.cs
│ │ │ │ │ │ ├── ParserMatchEventArgs.cs
│ │ │ │ │ │ ├── ParserMatchListenerBase.cs
│ │ │ │ │ │ ├── ParserMatchListener.cs
│ │ │ │ │ │ ├── ParserReporter.cs
│ │ │ │ │ │ ├── ParserTokenEventArgs.cs
│ │ │ │ │ │ ├── ParserTokenListenerBase.cs
│ │ │ │ │ │ ├── ParserTokenListener.cs
│ │ │ │ │ │ ├── ParseTreeDebugParser.cs
│ │ │ │ │ │ ├── ScannerEventSupport.cs
│ │ │ │ │ │ ├── SemanticPredicateEventArgs.cs
│ │ │ │ │ │ ├── SemanticPredicateListenerBase.cs
│ │ │ │ │ │ ├── SemanticPredicateListener.cs
│ │ │ │ │ │ ├── SyntacticPredicateEventArgs.cs
│ │ │ │ │ │ ├── SyntacticPredicateListenerBase.cs
│ │ │ │ │ │ ├── SyntacticPredicateListener.cs
│ │ │ │ │ │ ├── TraceEventArgs.cs
│ │ │ │ │ │ ├── TraceListenerBase.cs
│ │ │ │ │ │ ├── TraceListener.cs
│ │ │ │ │ │ └── Tracer.cs
│ │ │ │ │ ├── DefaultFileLineFormatter.cs
│ │ │ │ │ ├── DumpASTVisitor.cs
│ │ │ │ │ ├── FileLineFormatter.cs
│ │ │ │ │ ├── IHiddenStreamToken.cs
│ │ │ │ │ ├── InputBuffer.cs
│ │ │ │ │ ├── IToken.cs
│ │ │ │ │ ├── LexerSharedInputState.cs
│ │ │ │ │ ├── LLkParser.cs
│ │ │ │ │ ├── MismatchedCharException.cs
│ │ │ │ │ ├── MismatchedTokenException.cs
│ │ │ │ │ ├── NoViableAltException.cs
│ │ │ │ │ ├── NoViableAltForCharException.cs
│ │ │ │ │ ├── Parser.cs
│ │ │ │ │ ├── ParserSharedInputState.cs
│ │ │ │ │ ├── ParseTree.cs
│ │ │ │ │ ├── ParseTreeRule.cs
│ │ │ │ │ ├── ParseTreeToken.cs
│ │ │ │ │ ├── RecognitionException.cs
│ │ │ │ │ ├── SemanticException.cs
│ │ │ │ │ ├── StringUtils.cs
│ │ │ │ │ ├── SupportClass.cs
│ │ │ │ │ ├── TokenBuffer.cs
│ │ │ │ │ ├── TokenCreator.cs
│ │ │ │ │ ├── Token.cs
│ │ │ │ │ ├── TokenQueue.cs
│ │ │ │ │ ├── TokenStreamBasicFilter.cs
│ │ │ │ │ ├── TokenStream.cs
│ │ │ │ │ ├── TokenStreamException.cs
│ │ │ │ │ ├── TokenStreamHiddenTokenFilter.cs
│ │ │ │ │ ├── TokenStreamIOException.cs
│ │ │ │ │ ├── TokenStreamRecognitionException.cs
│ │ │ │ │ ├── TokenStreamRetryException.cs
│ │ │ │ │ ├── TokenStreamRewriteEngine.cs
│ │ │ │ │ ├── TokenStreamSelector.cs
│ │ │ │ │ ├── TokenWithIndex.cs
│ │ │ │ │ ├── TreeParser.cs
│ │ │ │ │ └── TreeParserSharedInputState.cs
│ │ │ │ ├── ExpressionLexer.cs
│ │ │ │ ├── ExpressionParser.cs
│ │ │ │ ├── ExpressionParserTokenTypes.cs
│ │ │ │ └── ExpressionParserTokenTypes.txt
│ │ │ ├── Processors
│ │ │ │ ├── AverageAggregator.cs
│ │ │ │ ├── ConversionProcessor.cs
│ │ │ │ ├── CountAggregator.cs
│ │ │ │ ├── DateConversionProcessor.cs
│ │ │ │ ├── DistinctProcessor.cs
│ │ │ │ ├── ICollectionProcessor.cs
│ │ │ │ ├── IMethodCallProcessor.cs
│ │ │ │ ├── MaxAggregator.cs
│ │ │ │ ├── MinAggregator.cs
│ │ │ │ ├── NonNullProcessor.cs
│ │ │ │ ├── OrderByProcessor.cs
│ │ │ │ ├── ReverseProcessor.cs
│ │ │ │ ├── SortProcessor.cs
│ │ │ │ └── SumAggregator.cs
│ │ │ ├── ProjectionNode.cs
│ │ │ ├── PropertyOrFieldNode.cs
│ │ │ ├── QualifiedIdentifier.cs
│ │ │ ├── RealLiteralNode.cs
│ │ │ ├── ReferenceNode.cs
│ │ │ ├── SelectionFirstNode.cs
│ │ │ ├── SelectionLastNode.cs
│ │ │ ├── SelectionNode.cs
│ │ │ ├── SpringAST.cs
│ │ │ ├── StringLiteralNode.cs
│ │ │ ├── SyntaxErrorException.cs
│ │ │ ├── TernaryNode.cs
│ │ │ ├── TypeNode.cs
│ │ │ ├── UnaryOperator.cs
│ │ │ └── VariableNode.cs
│ │ ├── Globalization
│ │ │ ├── AbstractLocalizer.cs
│ │ │ ├── AbstractResourceCache.cs
│ │ │ ├── Formatters
│ │ │ │ ├── BooleanFormatter.cs
│ │ │ │ ├── CurrencyFormatter.cs
│ │ │ │ ├── DateTimeFormatter.cs
│ │ │ │ ├── FilteringFormatter.cs
│ │ │ │ ├── FloatFormatter.cs
│ │ │ │ ├── HasTextFilteringFormatter.cs
│ │ │ │ ├── IntegerFormatter.cs
│ │ │ │ ├── NullFormatter.cs
│ │ │ │ ├── NumberFormatter.cs
│ │ │ │ └── PercentFormatter.cs
│ │ │ ├── ICultureResolver.cs
│ │ │ ├── IFormatter.cs
│ │ │ ├── ILocalizer.cs
│ │ │ ├── IResourceCache.cs
│ │ │ ├── Localizers
│ │ │ │ └── ResourceSetLocalizer.cs
│ │ │ ├── NullResourceCache.cs
│ │ │ ├── Resolvers
│ │ │ │ └── DefaultCultureResolver.cs
│ │ │ └── Resource.cs
│ │ ├── Objects
│ │ │ ├── Events
│ │ │ │ ├── IEventRegistryAware.cs
│ │ │ │ ├── IEventRegistry.cs
│ │ │ │ └── Support
│ │ │ │ ├── EventManipulationUtils.cs
│ │ │ │ └── EventRegistry.cs
│ │ │ ├── Factory
│ │ │ │ ├── Attributes
│ │ │ │ │ ├── RequiredAttribute.cs
│ │ │ │ │ └── RequiredAttributeObjectPostProcessor.cs
│ │ │ │ ├── Config
│ │ │ │ │ ├── AbstractConfigurer.cs
│ │ │ │ │ ├── AbstractFactoryObject.cs
│ │ │ │ │ ├── AutoWiringMode.cs
│ │ │ │ │ ├── CommandLineArgsVariableSource.cs
│ │ │ │ │ ├── ConfigSectionVariableSource.cs
│ │ │ │ │ ├── ConfigurableVariableSource.cs
│ │ │ │ │ ├── ConfigurationReader.cs
│ │ │ │ │ ├── ConnectionStringsVariableSource.cs
│ │ │ │ │ ├── ConstructorArgumentValues.cs
│ │ │ │ │ ├── CustomConverterConfigurer.cs
│ │ │ │ │ ├── DelegateFactoryObject.cs
│ │ │ │ │ ├── DelegateObjectFactoryConfigurer.cs
│ │ │ │ │ ├── DependencyDescriptor.cs
│ │ │ │ │ ├── DictionaryFactoryObject.cs
│ │ │ │ │ ├── DictionaryVariableSource.cs
│ │ │ │ │ ├── EnvironmentVariableMode.cs
│ │ │ │ │ ├── EnvironmentVariableSource.cs
│ │ │ │ │ ├── EventValues.cs
│ │ │ │ │ ├── ExpressionHolder.cs
│ │ │ │ │ ├── FieldRetrievingFactoryObject.cs
│ │ │ │ │ ├── IAutowireCapableObjectFactory.cs
│ │ │ │ │ ├── IConfigurableFactoryObject.cs
│ │ │ │ │ ├── IConfigurableListableObjectFactory.cs
│ │ │ │ │ ├── IConfigurableObjectFactory.cs
│ │ │ │ │ ├── ICustomValueReferenceHolder.cs
│ │ │ │ │ ├── IDestructionAwareObjectPostProcessor.cs
│ │ │ │ │ ├── IInstantiationAwareObjectPostProcessor.cs
│ │ │ │ │ ├── IManagedCollection.cs
│ │ │ │ │ ├── InstantiationAwareObjectPostProcessorAdapter.cs
│ │ │ │ │ ├── IObjectDefinition.cs
│ │ │ │ │ ├── IObjectFactoryPostProcessor.cs
│ │ │ │ │ ├── IObjectPostProcessor.cs
│ │ │ │ │ ├── ISingletonObjectRegistry.cs
│ │ │ │ │ ├── IVariableSource.cs
│ │ │ │ │ ├── ListFactoryObject.cs
│ │ │ │ │ ├── LogFactoryObject.cs
│ │ │ │ │ ├── ManagedDictionary.cs
│ │ │ │ │ ├── ManagedList.cs
│ │ │ │ │ ├── ManagedNameValueCollection.cs
│ │ │ │ │ ├── ManagedSet.cs
│ │ │ │ │ ├── MethodInvokingFactoryObject.cs
│ │ │ │ │ ├── ObjectDefinitionHolder.cs
│ │ │ │ │ ├── ObjectDefinitionVisitor.cs
│ │ │ │ │ ├── ObjectFactoryCreatingFactoryObject.cs
│ │ │ │ │ ├── ObjectReferenceFactoryObject.cs
│ │ │ │ │ ├── ObjectRole.cs
│ │ │ │ │ ├── PropertyFileVariableSource.cs
│ │ │ │ │ ├── PropertyOverrideConfigurer.cs
│ │ │ │ │ ├── PropertyPathFactoryObject.cs
│ │ │ │ │ ├── PropertyPlaceholderConfigurer.cs
│ │ │ │ │ ├── PropertyResourceConfigurer.cs
│ │ │ │ │ ├── PropertyRetrievingFactoryObject.cs
│ │ │ │ │ ├── RegistryVariableSource.cs
│ │ │ │ │ ├── ResourceHandlerConfigurer.cs
│ │ │ │ │ ├── ResourceManagerFactoryObject.cs
│ │ │ │ │ ├── RuntimeObjectReference.cs
│ │ │ │ │ ├── SetFactoryObject.cs
│ │ │ │ │ ├── SharedStateAwareProcessor.cs
│ │ │ │ │ ├── SmartInstantiationAwareObjectPostProcessor.cs
│ │ │ │ │ ├── SpecialFolderVariableSource.cs
│ │ │ │ │ ├── TypeAliasConfigurer.cs
│ │ │ │ │ ├── TypedStringValue.cs
│ │ │ │ │ ├── VariableAccessor.cs
│ │ │ │ │ └── VariablePlaceholderConfigurer.cs
│ │ │ │ ├── FactoryObjectNotInitializedException.cs
│ │ │ │ ├── IFactoryObject.cs
│ │ │ │ ├── IGenericObjectFactory.cs
│ │ │ │ ├── IHierarchicalObjectFactory.cs
│ │ │ │ ├── IInitializingObject.cs
│ │ │ │ ├── IListableObjectFactory.cs
│ │ │ │ ├── IObjectDefinitionFactory.cs
│ │ │ │ ├── IObjectFactoryAware.cs
│ │ │ │ ├── IObjectFactory.cs
│ │ │ │ ├── IObjectNameAware.cs
│ │ │ │ ├── NoSuchObjectDefinitionException.cs
│ │ │ │ ├── ObjectCreationException.cs
│ │ │ │ ├── ObjectCurrentlyInCreationException.cs
│ │ │ │ ├── ObjectDefinitionException.cs
│ │ │ │ ├── ObjectDefinitionStoreException.cs
│ │ │ │ ├── ObjectFactoryUtils.cs
│ │ │ │ ├── ObjectInitializationException.cs
│ │ │ │ ├── ObjectIsNotAFactoryException.cs
│ │ │ │ ├── ObjectNotOfRequiredTypeException.cs
│ │ │ │ ├── Parsing
│ │ │ │ │ ├── FailFastProblemReporter.cs
│ │ │ │ │ ├── IProblemReporter.cs
│ │ │ │ │ ├── Location.cs
│ │ │ │ │ ├── ObjectDefinitionParsingException.cs
│ │ │ │ │ ├── Problem.cs
│ │ │ │ │ └── ReaderContext.cs
│ │ │ │ ├── Support
│ │ │ │ │ ├── AbstractAutowireCapableObjectFactory.cs
│ │ │ │ │ ├── AbstractMethodReplacer.cs
│ │ │ │ │ ├── AbstractObjectDefinition.cs
│ │ │ │ │ ├── AbstractObjectDefinitionReader.cs
│ │ │ │ │ ├── AbstractObjectFactory.cs
│ │ │ │ │ ├── AutowireUtils.cs
│ │ │ │ │ ├── ChildObjectDefinition.cs
│ │ │ │ │ ├── ConstructorResolver.cs
│ │ │ │ │ ├── DefaultListableObjectFactory.cs
│ │ │ │ │ ├── DefaultObjectDefinitionFactory.cs
│ │ │ │ │ ├── DefaultObjectNameGenerator.cs
│ │ │ │ │ ├── DelegatingMethodReplacer.cs
│ │ │ │ │ ├── DependencyCheckingMode.cs
│ │ │ │ │ ├── GenericObjectDefinition.cs
│ │ │ │ │ ├── IAutowireCandidateResolver.cs
│ │ │ │ │ ├── IConfigurableObjectDefinition.cs
│ │ │ │ │ ├── IInstantiationStrategy.cs
│ │ │ │ │ ├── IMethodReplacer.cs
│ │ │ │ │ ├── IObjectDefinitionReader.cs
│ │ │ │ │ ├── IObjectDefinitionRegistry.cs
│ │ │ │ │ ├── IObjectDefinitionRegistryPostProcessor.cs
│ │ │ │ │ ├── IObjectNameGenerator.cs
│ │ │ │ │ ├── LookupMethodOverride.cs
│ │ │ │ │ ├── LookupMethodReplacer.cs
│ │ │ │ │ ├── MethodInjectingInstantiationStrategy.cs
│ │ │ │ │ ├── MethodOverride.cs
│ │ │ │ │ ├── MethodOverrides.cs
│ │ │ │ │ ├── ObjectDefinitionBuilder.cs
│ │ │ │ │ ├── ObjectDefinitionReaderUtils.cs
│ │ │ │ │ ├── ObjectDefinitionValidationException.cs
│ │ │ │ │ ├── ObjectDefinitionValueResolver.cs
│ │ │ │ │ ├── ObjectScope.cs
│ │ │ │ │ ├── PropertiesObjectDefinitionReader.cs
│ │ │ │ │ ├── RootObjectDefinition.cs
│ │ │ │ │ ├── SimpleAutowireCandidateResolver.cs
│ │ │ │ │ ├── SimpleInstantiationStrategy.cs
│ │ │ │ │ └── StaticListableObjectFactory.cs
│ │ │ │ ├── UnsatisfiedDependencyException.cs
│ │ │ │ └── Xml
│ │ │ │ ├── AbstractObjectDefinitionParser.cs
│ │ │ │ ├── AbstractSimpleObjectDefinitionParser.cs
│ │ │ │ ├── AbstractSingleObjectDefinitionParser.cs
│ │ │ │ ├── DefaultNamespaceHandlerResolver.cs
│ │ │ │ ├── DefaultObjectDefinitionDocumentReader.cs
│ │ │ │ ├── DocumentDefaultsDefinition.cs
│ │ │ │ ├── INamespaceParser.cs
│ │ │ │ ├── INamespaceParserResolver.cs
│ │ │ │ ├── IObjectDefinitionDocumentReader.cs
│ │ │ │ ├── IObjectDefinitionParser.cs
│ │ │ │ ├── NamespaceParserAttribute.cs
│ │ │ │ ├── NamespaceParserRegistry.cs
│ │ │ │ ├── NamespaceParserSupport.cs
│ │ │ │ ├── ObjectDefinitionConstants.cs
│ │ │ │ ├── ObjectDefinitionParserHelper.cs
│ │ │ │ ├── ObjectFactorySectionHandler.cs
│ │ │ │ ├── ObjectsNamespaceParser.cs
│ │ │ │ ├── ParserContext.cs
│ │ │ │ ├── ReplacedMethodOverride.cs
│ │ │ │ ├── spring-objects-1.1.xsd
│ │ │ │ ├── spring-objects-1.1.xsx
│ │ │ │ ├── spring-objects-1.3.xsd
│ │ │ │ ├── spring-objects-1.3.xsx
│ │ │ │ ├── spring-tool-1.1.xsd
│ │ │ │ ├── XmlObjectDefinitionReader.cs
│ │ │ │ ├── XmlObjectFactory.cs
│ │ │ │ └── XmlReaderContext.cs
│ │ │ ├── FatalObjectException.cs
│ │ │ ├── IEventHandlerValue.cs
│ │ │ ├── IMergable.cs
│ │ │ ├── IObjectWrapper.cs
│ │ │ ├── IPropertyValues.cs
│ │ │ ├── ISharedStateAware.cs
│ │ │ ├── ISharedStateFactory.cs
│ │ │ ├── MutablePropertyValues.cs
│ │ │ ├── ObjectsException.cs
│ │ │ ├── ObjectWrapper.cs
│ │ │ ├── PropertyAccessExceptionsException.cs
│ │ │ ├── PropertyValue.cs
│ │ │ └── Support
│ │ │ ├── AbstractEventHandlerValue.cs
│ │ │ ├── AbstractSharedStateFactory.cs
│ │ │ ├── AbstractWiringEventHandlerValue.cs
│ │ │ ├── ArgumentConvertingMethodInvoker.cs
│ │ │ ├── AutoWiringEventHandlerValue.cs
│ │ │ ├── ByTypeSharedStateFactory.cs
│ │ │ ├── InstanceEventHandlerValue.cs
│ │ │ ├── ISortDefinition.cs
│ │ │ ├── MethodInvoker.cs
│ │ │ ├── MutableSortDefinition.cs
│ │ │ ├── PropertyComparator.cs
│ │ │ └── StaticEventHandlerValue.cs
│ │ ├── Pool
│ │ │ ├── IObjectPool.cs
│ │ │ ├── IPoolableObjectFactory.cs
│ │ │ ├── PoolException.cs
│ │ │ └── Support
│ │ │ └── SimplePool.cs
│ │ ├── Proxy
│ │ │ ├── AbstractProxyMethodBuilder.cs
│ │ │ ├── AbstractProxyTypeBuilder.cs
│ │ │ ├── BaseProxyMethodBuilder.cs
│ │ │ ├── CompositionProxyTypeBuilder.cs
│ │ │ ├── DynamicProxyManager.cs
│ │ │ ├── InheritanceProxyTypeBuilder.cs
│ │ │ ├── IProxyMethodBuilder.cs
│ │ │ ├── IProxyTypeBuilder.cs
│ │ │ ├── IProxyTypeGenerator.cs
│ │ │ ├── ProxyIgnoreAttribute.cs
│ │ │ └── TargetProxyMethodBuilder.cs
│ │ ├── README_ANTLR.txt
│ │ ├── Reflection
│ │ │ └── Dynamic
│ │ │ ├── BaseDynamicMember.cs
│ │ │ ├── DynamicConstructor.cs
│ │ │ ├── DynamicField.cs
│ │ │ ├── DynamicIndexer.cs
│ │ │ ├── DynamicMethod.cs
│ │ │ ├── DynamicProperty.cs
│ │ │ └── DynamicReflectionManager.cs
│ │ ├── Resources
│ │ │ └── Strings.resx
│ │ ├── Spring.Core.2002.csproj
│ │ ├── Spring.Core.2003.csproj
│ │ ├── Spring.Core.2005.csproj
│ │ ├── Spring.Core.2008.csproj
│ │ ├── Spring.Core.2010.csproj
│ │ ├── Spring.Core.build
│ │ ├── Spring.Core.nuspec
│ │ ├── Spring.Core.xml
│ │ ├── Stereotype
│ │ │ ├── ComponentAttribute.cs
│ │ │ ├── RepositoryAttribute.cs
│ │ │ └── ServiceAttribute.cs
│ │ ├── Threading
│ │ │ ├── CallContextStorage.cs
│ │ │ ├── ISync.cs
│ │ │ ├── IThreadStorage.cs
│ │ │ ├── Latch.cs
│ │ │ ├── LogicalThreadContext.cs
│ │ │ ├── Semaphore.cs
│ │ │ ├── SyncHolder.cs
│ │ │ ├── ThreadStaticStorage.cs
│ │ │ ├── TimeoutException.cs
│ │ │ ├── TimeoutSync.cs
│ │ │ └── Utils.cs
│ │ ├── Util
│ │ │ ├── ArrayUtils.cs
│ │ │ ├── AssertUtils.cs
│ │ │ ├── AttributeUtils.cs
│ │ │ ├── CollectionUtils.cs
│ │ │ ├── CompareUtils.cs
│ │ │ ├── ConfigurationUtils.cs
│ │ │ ├── ConfigXmlAttribute.cs
│ │ │ ├── ConfigXmlDocument.cs
│ │ │ ├── ConfigXmlElement.cs
│ │ │ ├── ConstructorInstantiationInfo.cs
│ │ │ ├── DelegateInfo.cs
│ │ │ ├── DynamicCodeManager.cs
│ │ │ ├── EventUtils.cs
│ │ │ ├── FatalReflectionException.cs
│ │ │ ├── Generic
│ │ │ │ └── CollectionUtils.cs
│ │ │ ├── IChainableConfigSystem.cs
│ │ │ ├── IErrorHandler.cs
│ │ │ ├── IEventExceptionsCollector.cs
│ │ │ ├── IoUtils.cs
│ │ │ ├── ITextPosition.cs
│ │ │ ├── NumberUtils.cs
│ │ │ ├── ObjectUtils.cs
│ │ │ ├── PathMatcher.cs
│ │ │ ├── PatternMatchUtils.cs
│ │ │ ├── Properties.cs
│ │ │ ├── ReflectionException.cs
│ │ │ ├── ReflectionUtils.cs
│ │ │ ├── SecurityCritical.cs
│ │ │ ├── StringUtils.cs
│ │ │ ├── SystemUtils.cs
│ │ │ ├── TextPositionInfo.cs
│ │ │ ├── UniqueKey.cs
│ │ │ └── XmlUtils.cs
│ │ └── Validation
│ │ ├── Actions
│ │ │ ├── ErrorMessageAction.cs
│ │ │ ├── ExceptionAction.cs
│ │ │ └── ExpressionAction.cs
│ │ ├── AnyValidatorGroup.cs
│ │ ├── BaseSimpleValidator.cs
│ │ ├── BaseValidationAction.cs
│ │ ├── BaseValidator.cs
│ │ ├── BaseValidatorGroup.cs
│ │ ├── CollectionValidator.cs
│ │ ├── Config
│ │ │ ├── spring-validation-1.1.xsd
│ │ │ ├── spring-validation-1.3.xsd
│ │ │ └── ValidationNamespaceParser.cs
│ │ ├── ErrorMessage.cs
│ │ ├── ExclusiveValidatorGroup.cs
│ │ ├── IValidationAction.cs
│ │ ├── IValidationErrors.cs
│ │ ├── IValidator.cs
│ │ ├── ValidatedAttribute.cs
│ │ ├── ValidationErrors.cs
│ │ ├── ValidationException.cs
│ │ ├── ValidatorGroup.cs
│ │ ├── ValidatorReference.cs
│ │ └── Validators
│ │ ├── ConditionValidator.cs
│ │ ├── CreditCardValidator.cs
│ │ ├── EmailValidator.cs
│ │ ├── ISBNValidator.cs
│ │ ├── RegularExpressionValidator.cs
│ │ ├── RequiredValidator.cs
│ │ └── UrlValidator.cs
│ ├── Spring.Data
│ │ ├── AssemblyInfo.cs
│ │ ├── Dao
│ │ │ ├── Attributes
│ │ │ │ ├── PersistenceExceptionTranslationAdvisor.cs
│ │ │ │ └── PersistenceExceptionTranslationPostProcessor.cs
│ │ │ ├── CannotAcquireLockException.cs
│ │ │ ├── CannotSerializeTransactionException.cs
│ │ │ ├── CleanupFailureDataAccessException.cs
│ │ │ ├── ConcurrencyFailureException.cs
│ │ │ ├── DataAccessException.cs
│ │ │ ├── DataAccessResourceFailureException.cs
│ │ │ ├── DataIntegrityViolationException.cs
│ │ │ ├── DataRetrievalFailureException.cs
│ │ │ ├── DeadlockLoserDataAccessException.cs
│ │ │ ├── EmptyResultDataAccessException.cs
│ │ │ ├── IncorrectResultSizeDataAccessException.cs
│ │ │ ├── IncorrectUpdateSemanticsDataAccessException.cs
│ │ │ ├── InvalidDataAccessApiUsageException.cs
│ │ │ ├── InvalidDataAccessResourceUsageException.cs
│ │ │ ├── NonTransientDataAccessException.cs
│ │ │ ├── NonTransientDataAccessResourceException.cs
│ │ │ ├── ObjectOptimisticLockingFailureException.cs
│ │ │ ├── ObjectRetrievalFailureException.cs
│ │ │ ├── OptimisticLockingFailureException.cs
│ │ │ ├── PermissionDeniedDataAccessException.cs
│ │ │ ├── PessimisticLockingFailureException.cs
│ │ │ ├── Support
│ │ │ │ ├── ChainedPersistenceExceptionTranslator.cs
│ │ │ │ ├── DaoSupport.cs
│ │ │ │ ├── DataAccessUtils.cs
│ │ │ │ ├── Generic
│ │ │ │ │ └── DataAccessUtils.cs
│ │ │ │ ├── IPersistenceExceptionTranslator.cs
│ │ │ │ └── PersistenceExceptionTranslationInterceptor.cs
│ │ │ ├── TransientDataAccessException.cs
│ │ │ ├── TransientDataAccessResourceException.cs
│ │ │ ├── TypeMismatchDataAccessException.cs
│ │ │ └── UncategorizedDataAccessException.cs
│ │ ├── Data
│ │ │ ├── BadSqlGrammarException.cs
│ │ │ ├── CannotGetAdoConnectionException.cs
│ │ │ ├── CommandDelegate.cs
│ │ │ ├── CommandSetterDelegate.cs
│ │ │ ├── Common
│ │ │ │ ├── DbMetadata.cs
│ │ │ │ ├── DbParameter.cs
│ │ │ │ ├── DbParametersBuilder.cs
│ │ │ │ ├── DbParameters.cs
│ │ │ │ ├── DbProviderConfigurer.cs
│ │ │ │ ├── DbProvider.cs
│ │ │ │ ├── DbProviderFactory.cs
│ │ │ │ ├── DbProviderFactoryObject.cs
│ │ │ │ ├── dbproviders.xml
│ │ │ │ ├── DelegatingDbProvider.cs
│ │ │ │ ├── ErrorCodes.cs
│ │ │ │ ├── IDbMetadata.cs
│ │ │ │ ├── IDbParameter.cs
│ │ │ │ ├── IDbParametersBuilder.cs
│ │ │ │ ├── IDbParameters.cs
│ │ │ │ ├── IDbProvider.cs
│ │ │ │ ├── MultiDelegatingDbProvider.cs
│ │ │ │ └── UserCredentialsDbProvider.cs
│ │ │ ├── Config
│ │ │ │ ├── DatabaseNamespaceParser.cs
│ │ │ │ ├── spring-database-1.1.xsd
│ │ │ │ ├── spring-database-1.1.xsx
│ │ │ │ ├── spring-database-1.3.xsd
│ │ │ │ └── spring-database-1.3.xsx
│ │ │ ├── Core
│ │ │ │ ├── AdoAccessor.cs
│ │ │ │ ├── AdoDaoSupport.cs
│ │ │ │ ├── AdoPlatformTransactionManager.cs
│ │ │ │ ├── AdoTemplate.cs
│ │ │ │ ├── RowMapperResultSetExtractor.cs
│ │ │ │ ├── ServiceDomainPlatformTransactionManager.cs
│ │ │ │ └── TxScopeTransactionManager.cs
│ │ │ ├── DuplicateKeyException.cs
│ │ │ ├── Generic
│ │ │ │ ├── AdoDaoSupport.cs
│ │ │ │ ├── AdoTemplate.cs
│ │ │ │ ├── CommandDelegate.cs
│ │ │ │ ├── DataAdapterDelegate.cs
│ │ │ │ ├── IAdoOperations.cs
│ │ │ │ ├── ICommandCallback.cs
│ │ │ │ ├── IDataAdapterCallback.cs
│ │ │ │ ├── IDbCommandCallback.cs
│ │ │ │ ├── IDbCommandDelegate.cs
│ │ │ │ ├── IResultSetExtractor.cs
│ │ │ │ ├── IRowMapper.cs
│ │ │ │ ├── NamedResultSetProcessor.cs
│ │ │ │ ├── ResultSetExtractorDelegate.cs
│ │ │ │ ├── RowMapperDelegate.cs
│ │ │ │ └── RowMapperResultSetExtractor.cs
│ │ │ ├── IAdoOperations.cs
│ │ │ ├── ICommandCallback.cs
│ │ │ ├── ICommandSetter.cs
│ │ │ ├── ICommandTextProvider.cs
│ │ │ ├── ICommonAdoOperations.cs
│ │ │ ├── IDataAdapterCallback.cs
│ │ │ ├── IDataAdapterSetter.cs
│ │ │ ├── IDataReaderWrapper.cs
│ │ │ ├── IDataSetFillLifecycleProcessor.cs
│ │ │ ├── IDbCommandCreator.cs
│ │ │ ├── IDbCommandCreatorFactory.cs
│ │ │ ├── IDbDataAdapterCreator.cs
│ │ │ ├── InvalidResultSetAccessException.cs
│ │ │ ├── IResultSetExtractor.cs
│ │ │ ├── IRowCallback.cs
│ │ │ ├── IRowMapper.cs
│ │ │ ├── Objects
│ │ │ │ ├── AbstractAdoOperation.cs
│ │ │ │ ├── AdoNonQuery.cs
│ │ │ │ ├── AdoOperation.cs
│ │ │ │ ├── AdoQuery.cs
│ │ │ │ ├── AdoScalar.cs
│ │ │ │ ├── Generic
│ │ │ │ │ ├── AdoOperation.cs
│ │ │ │ │ ├── AdoQuery.cs
│ │ │ │ │ ├── MappingAdoQuery.cs
│ │ │ │ │ ├── MappingAdoQueryWithContext.cs
│ │ │ │ │ └── StoredProcedure.cs
│ │ │ │ ├── MappingAdoQuery.cs
│ │ │ │ ├── MappingAdoQueryWithContext.cs
│ │ │ │ └── StoredProcedure.cs
│ │ │ ├── ResultSetExtractorDelegate.cs
│ │ │ ├── RowCallbackDelegate.cs
│ │ │ ├── RowMapperDelegate.cs
│ │ │ ├── Support
│ │ │ │ ├── AdoTransactionObjectSupport.cs
│ │ │ │ ├── AdoUtils.cs
│ │ │ │ ├── ConnectionHolder.cs
│ │ │ │ ├── ConnectionSynchronization.cs
│ │ │ │ ├── ConnectionTxPair.cs
│ │ │ │ ├── ConnectionUtils.cs
│ │ │ │ ├── DefaultServiceDomainAdapter.cs
│ │ │ │ ├── DefaultTransactionScopeAdapter.cs
│ │ │ │ ├── ErrorCodeExceptionTranslator.cs
│ │ │ │ ├── FallbackExceptionTranslator.cs
│ │ │ │ ├── IAdoExceptionTranslator.cs
│ │ │ │ ├── IServiceDomainAdapter.cs
│ │ │ │ ├── ITransactionScopeAdapter.cs
│ │ │ │ ├── NamedResultSetProcessor.cs
│ │ │ │ ├── NullMappingDataReader.cs
│ │ │ │ ├── ParameterUtils.cs
│ │ │ │ ├── RowCallbackResultSetExtractor.cs
│ │ │ │ ├── SimpleServiceConfig.cs
│ │ │ │ ├── Sql
│ │ │ │ │ └── sqlconnectionstring.xsd
│ │ │ │ └── TypedDataSetUtils.cs
│ │ │ └── UncategorizedAdoException.cs
│ │ ├── Spring.Data.2003.csproj
│ │ ├── Spring.Data.2005.csproj
│ │ ├── Spring.Data.2008.csproj
│ │ ├── Spring.Data.2010.csproj
│ │ ├── Spring.Data.build
│ │ ├── Spring.Data.nuspec
│ │ ├── Spring.Data.xml
│ │ └── Transaction
│ │ ├── CannotCreateTransactionException.cs
│ │ ├── Config
│ │ │ ├── AttributeDrivenObjectDefinitionParser.cs
│ │ │ ├── spring-tx-1.1.xsd
│ │ │ ├── TxAdviceObjectDefinitionParser.cs
│ │ │ ├── TxNamespaceParser.cs
│ │ │ └── TxNamespaceUtils.cs
│ │ ├── HeuristicCompletionException.cs
│ │ ├── IllegalTransactionStateException.cs
│ │ ├── Interceptor
│ │ │ ├── AbstractFallbackTransactionAttributeSource.cs
│ │ │ ├── AbstractTransactionAttributeSourcePointcut.cs
│ │ │ ├── AttributesTransactionAttributeSource.cs
│ │ │ ├── DefaultTransactionAttribute.cs
│ │ │ ├── DefaultTransactionAttributeSourceAdvisor.cs
│ │ │ ├── DelegatingTransactionAttributeWithName.cs
│ │ │ ├── ITransactionAttribute.cs
│ │ │ ├── ITransactionAttributeSource.cs
│ │ │ ├── MatchAlwaysTransactionAttributeSource.cs
│ │ │ ├── MethodMapTransactionAttributeSource.cs
│ │ │ ├── NameMatchTransactionAttributeSource.cs
│ │ │ ├── NoRollbackRuleAttribute.cs
│ │ │ ├── ObjectFactoryTransactionAttributeSourceAdvisor.cs
│ │ │ ├── RollbackRuleAttribute.cs
│ │ │ ├── RuleBasedTransactionAttribute.cs
│ │ │ ├── TransactionAspectSupport.cs
│ │ │ ├── TransactionAttributeConverter.cs
│ │ │ ├── TransactionAttribute.cs
│ │ │ ├── TransactionAttributeEditor.cs
│ │ │ ├── TransactionAttributeSourceAdvisor.cs
│ │ │ ├── TransactionAttributeSourceEditor.cs
│ │ │ ├── TransactionInterceptor.cs
│ │ │ └── TransactionProxyFactoryObject.cs
│ │ ├── InvalidIsolationLevelException.cs
│ │ ├── InvalidTimeoutException.cs
│ │ ├── IPlatformTransactionManager.cs
│ │ ├── ISavepointManager.cs
│ │ ├── ITransactionDefinition.cs
│ │ ├── ITransactionStatus.cs
│ │ ├── NestedTransactionNotSupportedException.cs
│ │ ├── NoTransactionException.cs
│ │ ├── Support
│ │ │ ├── AbstractPlatformTransactionManager.cs
│ │ │ ├── DefaultTransactionDefinition.cs
│ │ │ ├── DefaultTransactionStatus.cs
│ │ │ ├── IResourceTransactionManager.cs
│ │ │ ├── ISmartTransactionObject.cs
│ │ │ ├── ITransactionCallback.cs
│ │ │ ├── ITransactionOperations.cs
│ │ │ ├── ITransactionSynchronization.cs
│ │ │ ├── ResourceHolderSupport.cs
│ │ │ ├── TransactionCallbackWithoutResult.cs
│ │ │ ├── TransactionDelegate.cs
│ │ │ ├── TransactionSynchronizationAdapter.cs
│ │ │ ├── TransactionSynchronizationManager.cs
│ │ │ ├── TransactionSynchronizationState.cs
│ │ │ ├── TransactionSynchronizationStatus.cs
│ │ │ └── TransactionTemplate.cs
│ │ ├── TransactionException.cs
│ │ ├── TransactionOutcomeState.cs
│ │ ├── TransactionPropagation.cs
│ │ ├── TransactionSuspensionNotSupportedException.cs
│ │ ├── TransactionSystemException.cs
│ │ ├── TransactionTimedOutException.cs
│ │ ├── TransactionUsageException.cs
│ │ └── UnexpectedRollbackException.cs
│ ├── Spring.Data.NHibernate
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── HibernateAccessor.cs
│ │ │ ├── HibernateAdoException.cs
│ │ │ ├── HibernateDelegate.cs
│ │ │ ├── HibernateObjectRetrievalFailureException.cs
│ │ │ ├── HibernateOptimisticLockingFailureException.cs
│ │ │ ├── HibernateQueryException.cs
│ │ │ ├── HibernateSystemException.cs
│ │ │ ├── HibernateTemplate.cs
│ │ │ ├── HibernateTransactionManager.cs
│ │ │ ├── ICommonHibernateOperations.cs
│ │ │ ├── IHibernateCallback.cs
│ │ │ ├── IHibernateOperations.cs
│ │ │ ├── LocalSessionFactoryObject.cs
│ │ │ ├── SessionFactoryUtils.cs
│ │ │ ├── SessionHolder.cs
│ │ │ ├── SpringSessionSynchronization.cs
│ │ │ ├── Support
│ │ │ │ ├── ConfigSectionSessionScopeSettings.cs
│ │ │ │ ├── HibernateDaoSupport.cs
│ │ │ │ ├── OpenSessionInViewModule.cs
│ │ │ │ ├── SessionScope.cs
│ │ │ │ └── SessionScopeSettings.cs
│ │ │ └── TemplateFlushMode.cs
│ │ ├── Spring.Data.NHibernate.2003.csproj
│ │ ├── Spring.Data.NHibernate.2005.csproj
│ │ ├── Spring.Data.NHibernate.2008.csproj
│ │ └── Spring.Data.NHibernate.build
│ ├── Spring.Data.NHibernate12
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Generic
│ │ │ │ ├── FindHibernateDelegate.cs
│ │ │ │ ├── HibernateDaoSupport.cs
│ │ │ │ ├── HibernateDelegate.cs
│ │ │ │ ├── HibernateTemplate.cs
│ │ │ │ ├── IFindHibernateCallback.cs
│ │ │ │ ├── IHibernateCallback.cs
│ │ │ │ └── IHibernateOperations.cs
│ │ │ ├── HibernateAccessor.cs
│ │ │ ├── HibernateOptimisticLockingFailureException.cs
│ │ │ ├── LocalSessionFactoryObject.cs
│ │ │ ├── SessionFactoryUtils.cs
│ │ │ ├── SpringSessionContext.cs
│ │ │ ├── SpringSessionSynchronization.cs
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate12.2003.csproj
│ │ ├── Spring.Data.NHibernate12.2005.csproj
│ │ ├── Spring.Data.NHibernate12.2008.csproj
│ │ ├── Spring.Data.NHibernate12.2010.csproj
│ │ ├── Spring.Data.NHibernate12.build
│ │ ├── Spring.Data.NHibernate12.nuspec
│ │ └── Spring.Data.NHibernate12.xml
│ ├── Spring.Data.NHibernate20
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── FilterDefiniitionFactoryObject.cs
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ ├── HibernateObjectRetrievalFailureException.cs
│ │ │ ├── HibernateOptimisticLockingFailureException.cs
│ │ │ ├── LocalSessionFactoryObject.cs
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate20.2005.csproj
│ │ ├── Spring.Data.NHibernate20.2008.csproj
│ │ ├── Spring.Data.NHibernate20.2010.csproj
│ │ ├── Spring.Data.NHibernate20.build
│ │ ├── Spring.Data.NHibernate20.nuspec
│ │ └── Spring.Data.NHibernate20.xml
│ ├── Spring.Data.NHibernate21
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Bytecode
│ │ │ │ ├── BytecodeProvider.cs
│ │ │ │ ├── LazyInitializer.cs
│ │ │ │ ├── ObjectsFactory.cs
│ │ │ │ ├── ProxyFactory.cs
│ │ │ │ ├── ProxyFactoryFactory.cs
│ │ │ │ └── ReflectionOptimizer.cs
│ │ │ ├── DelegatingLocalSessionFactoryObject.cs
│ │ │ ├── DelegatingSessionFactory.cs
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ ├── HibernateTxScopeTransactionManager.cs
│ │ │ ├── SimpleDelegatingSessionFactory.cs
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate21.2005.csproj
│ │ ├── Spring.Data.NHibernate21.2008.csproj
│ │ ├── Spring.Data.NHibernate21.2010.csproj
│ │ ├── Spring.Data.NHibernate21.build
│ │ ├── Spring.Data.NHibernate21.nuspec
│ │ └── Spring.Data.NHibernate21.xml
│ ├── Spring.Data.NHibernate30
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Bytecode
│ │ │ │ └── dontdelete.txt
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate30.2008.csproj
│ │ ├── Spring.Data.NHibernate30.2010.csproj
│ │ ├── Spring.Data.NHibernate30.build
│ │ ├── Spring.Data.NHibernate30.nuspec
│ │ └── Spring.Data.NHibernate30.xml
│ ├── Spring.Data.NHibernate31
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Bytecode
│ │ │ │ └── dontdelete.txt
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate31.2008.csproj
│ │ ├── Spring.Data.NHibernate31.2010.csproj
│ │ ├── Spring.Data.NHibernate31.build
│ │ ├── Spring.Data.NHibernate31.nuspec
│ │ └── Spring.Data.NHibernate31.xml
│ ├── Spring.Data.NHibernate32
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Bytecode
│ │ │ │ └── dontdelete.txt
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate32.2008.csproj
│ │ ├── Spring.Data.NHibernate32.2010.csproj
│ │ ├── Spring.Data.NHibernate32.build
│ │ ├── Spring.Data.NHibernate32.nuspec
│ │ └── Spring.Data.NHibernate32.xml
│ ├── Spring.Messaging
│ │ ├── AssemblyInfo.cs
│ │ ├── Messaging
│ │ │ ├── Core
│ │ │ │ ├── DefaultMessageQueueFactory.cs
│ │ │ │ ├── IMessageQueueFactory.cs
│ │ │ │ ├── IMessageQueueOperations.cs
│ │ │ │ ├── LocallyExposedMessageQueueResourceHolder.cs
│ │ │ │ ├── MessagePostProcessorDelegate.cs
│ │ │ │ ├── MessageQueueGatewaySupport.cs
│ │ │ │ ├── MessageQueueMetadataCache.cs
│ │ │ │ ├── MessageQueueMetadata.cs
│ │ │ │ ├── MessageQueueResourceHolder.cs
│ │ │ │ ├── MessageQueueTemplate.cs
│ │ │ │ ├── MessageQueueTransactionManager.cs
│ │ │ │ └── QueueUtils.cs
│ │ │ ├── Listener
│ │ │ │ ├── AbstractListenerContainer.cs
│ │ │ │ ├── AbstractMessageListenerContainer.cs
│ │ │ │ ├── AbstractPeekingMessageListenerContainer.cs
│ │ │ │ ├── AbstractSendToQueueExceptionHandler.cs
│ │ │ │ ├── AbstractTransactionalMessageListenerContainer.cs
│ │ │ │ ├── DistributedTxMessageListenerContainer.cs
│ │ │ │ ├── IDistributedTransactionExceptionHandler.cs
│ │ │ │ ├── IExceptionHandler.cs
│ │ │ │ ├── IMessageListener.cs
│ │ │ │ ├── IMessageTransactionExceptionHandler.cs
│ │ │ │ ├── ListenerClassDiagram.cd
│ │ │ │ ├── ListenerExecutionFailedException.cs
│ │ │ │ ├── MessageListenerAdapter.cs
│ │ │ │ ├── NonTransactionalMessageListenerContainer.cs
│ │ │ │ ├── SendToQueueDistributedTransactionExceptionHandler.cs
│ │ │ │ ├── SendToQueueExceptionHandler.cs
│ │ │ │ ├── TransactionAction.cs
│ │ │ │ └── TransactionalMessageListenerContainer.cs
│ │ │ ├── MessagingException.cs
│ │ │ └── Support
│ │ │ ├── Converters
│ │ │ │ ├── ActiveXMessageConverter.cs
│ │ │ │ ├── BinaryMessageConverter.cs
│ │ │ │ ├── IMessageConverter.cs
│ │ │ │ ├── MessageConverterCreatorDelegate.cs
│ │ │ │ ├── MessageConverterFactoryObject.cs
│ │ │ │ ├── XmlDocumentConverter.cs
│ │ │ │ └── XmlMessageConverter.cs
│ │ │ ├── MessageQueueCreatorDelegate.cs
│ │ │ └── MessageQueueFactoryObject.cs
│ │ ├── Properties
│ │ ├── Spring.Messaging.2005.csproj
│ │ ├── Spring.Messaging.2008.csproj
│ │ ├── Spring.Messaging.2010.csproj
│ │ ├── Spring.Messaging.build
│ │ ├── Spring.Messaging.nuspec
│ │ └── Spring.Messaging.xml
│ ├── Spring.Messaging.Ems
│ │ ├── AssemblyInfo.cs
│ │ ├── Messaging
│ │ │ └── Ems
│ │ │ ├── Common
│ │ │ │ ├── EmsConnection.cs
│ │ │ │ ├── EmsConnectionFactory.cs
│ │ │ │ ├── EmsMessageConsumer.cs
│ │ │ │ ├── EmsMessageProducer.cs
│ │ │ │ ├── EmsSession.cs
│ │ │ │ ├── EmsSSLFileStoreInfo.cs
│ │ │ │ ├── EmsSSLSystemStoreInfo.cs
│ │ │ │ ├── EmsTopicSubscriber.cs
│ │ │ │ ├── IConnection.cs
│ │ │ │ ├── IConnectionFactory.cs
│ │ │ │ ├── IEmsSSLStoreType.cs
│ │ │ │ ├── IMessageConsumer.cs
│ │ │ │ ├── IMessageProducer.cs
│ │ │ │ ├── ISession.cs
│ │ │ │ └── ITopicSubscriber.cs
│ │ │ ├── Config
│ │ │ │ ├── EmsNamespaceParser.cs
│ │ │ │ ├── MessageListenerContainerObjectDefinitionParser.cs
│ │ │ │ └── spring-ems-1.3.xsd
│ │ │ ├── Connections
│ │ │ │ ├── CachedMessageConsumer .cs
│ │ │ │ ├── CachedMessageProducer.cs
│ │ │ │ ├── CachedSession.cs
│ │ │ │ ├── CachingConnectionFactory.cs
│ │ │ │ ├── ChainedExceptionListener.cs
│ │ │ │ ├── ConnectionFactoryUtils.cs
│ │ │ │ ├── EmsResourceHolder.cs
│ │ │ │ ├── EmsTransactionManager.cs
│ │ │ │ ├── IDecoratorSession.cs
│ │ │ │ ├── ISmartConnectionFactory.cs
│ │ │ │ ├── SingleConnectionFactory.cs
│ │ │ │ └── SynchedLocalTransactionFailedException.cs
│ │ │ ├── Core
│ │ │ │ ├── BrowserDelegate.cs
│ │ │ │ ├── EmsGatewaySupport.cs
│ │ │ │ ├── EmsTemplate.cs
│ │ │ │ ├── IBrowserCallback.cs
│ │ │ │ ├── IEmsOperations.cs
│ │ │ │ ├── IMessageCreator.cs
│ │ │ │ ├── IMessagePostProcessor.cs
│ │ │ │ ├── IProducerCallback.cs
│ │ │ │ ├── ISessionCallback.cs
│ │ │ │ ├── MessageCreatorDelegate.cs
│ │ │ │ ├── MessagePostProcessorDelegate.cs
│ │ │ │ ├── ProducerDelegate.cs
│ │ │ │ └── SessionDelegate.cs
│ │ │ ├── Jndi
│ │ │ │ ├── JndiAccessor.cs
│ │ │ │ ├── JndiContextType.cs
│ │ │ │ ├── JndiLocatorSupport.cs
│ │ │ │ ├── JndiLookupFactoryObject.cs
│ │ │ │ ├── JndiObjectLocator.cs
│ │ │ │ ├── LookupContextFactoryObject.cs
│ │ │ │ └── TypeMismatchNamingException.cs
│ │ │ ├── Listener
│ │ │ │ ├── AbstractListenerContainer.cs
│ │ │ │ ├── AbstractMessageListenerContainer.cs
│ │ │ │ ├── Adapter
│ │ │ │ │ ├── ListenerExecutionFailedException.cs
│ │ │ │ │ └── MessageListenerAdapter.cs
│ │ │ │ ├── ISessionAwareMessageListener.cs
│ │ │ │ ├── LocallyExposedEmsResourceHolder.cs
│ │ │ │ ├── RecoveryTimeExceededException.cs
│ │ │ │ └── SimpleMessageListenerContainer.cs
│ │ │ └── Support
│ │ │ ├── Converter
│ │ │ │ ├── IMessageConverter.cs
│ │ │ │ ├── ITypeMapper.cs
│ │ │ │ ├── MessageConversionException.cs
│ │ │ │ ├── SimpleMessageConverter.cs
│ │ │ │ ├── TypeMapper.cs
│ │ │ │ └── XmlMessageConverter.cs
│ │ │ ├── Destinations
│ │ │ │ ├── DynamicDestinationResolver.cs
│ │ │ │ ├── EmsDestinationAccessor.cs
│ │ │ │ └── IDestinationResolver.cs
│ │ │ ├── EmsAccessor.cs
│ │ │ └── EmsUtils.cs
│ │ ├── Spring.Messaging.Ems.2005.csproj
│ │ ├── Spring.Messaging.Ems.2008.csproj
│ │ ├── Spring.Messaging.Ems.2010.csproj
│ │ ├── Spring.Messaging.Ems.build
│ │ ├── Spring.Messaging.Ems.nuspec
│ │ └── Spring.Messaging.Ems.xml
│ ├── Spring.Messaging.Nms
│ │ ├── AssemblyInfo.cs
│ │ ├── Messaging
│ │ │ └── Nms
│ │ │ ├── Config
│ │ │ │ ├── MessageListenerContainerObjectDefinitionParser.cs
│ │ │ │ ├── NmsNamespaceParser.cs
│ │ │ │ ├── spring-nms-1.2.xsd
│ │ │ │ └── spring-nms-1.3.xsd
│ │ │ ├── Connections
│ │ │ │ ├── CachedMessageConsumer .cs
│ │ │ │ ├── CachedMessageProducer.cs
│ │ │ │ ├── CachedSession.cs
│ │ │ │ ├── CachingConnectionFactory.cs
│ │ │ │ ├── ChainedExceptionListener.cs
│ │ │ │ ├── ConnectionFactoryUtils.cs
│ │ │ │ ├── IDecoratorSession.cs
│ │ │ │ ├── ISmartConnectionFactory.cs
│ │ │ │ ├── NmsResourceHolder.cs
│ │ │ │ ├── NmsTransactionManager.cs
│ │ │ │ ├── SingleConnectionFactory.cs
│ │ │ │ └── SynchedLocalTransactionFailedException.cs
│ │ │ ├── Core
│ │ │ │ ├── IExceptionListener.cs
│ │ │ │ ├── IMessageCreator.cs
│ │ │ │ ├── IMessageListener.cs
│ │ │ │ ├── IMessagePostProcessor.cs
│ │ │ │ ├── INmsOperations.cs
│ │ │ │ ├── IProducerCallback.cs
│ │ │ │ ├── ISessionCallback.cs
│ │ │ │ ├── MessageCreatorDelegate.cs
│ │ │ │ ├── MessagePostProcessorDelegate.cs
│ │ │ │ ├── NmsGatewaySupport.cs
│ │ │ │ ├── NmsTemplate.cs
│ │ │ │ ├── NmsTrace.cs
│ │ │ │ ├── ProducerDelegate.cs
│ │ │ │ └── SessionDelegate.cs
│ │ │ ├── Listener
│ │ │ │ ├── AbstractListenerContainer.cs
│ │ │ │ ├── AbstractMessageListenerContainer.cs
│ │ │ │ ├── Adapter
│ │ │ │ │ ├── ListenerExecutionFailedException.cs
│ │ │ │ │ └── MessageListenerAdapter.cs
│ │ │ │ ├── ISessionAwareMessageListener.cs
│ │ │ │ ├── LocallyExposedNmsResourceHolder.cs
│ │ │ │ ├── RecoveryTimeExceededException.cs
│ │ │ │ └── SimpleMessageListenerContainer.cs
│ │ │ └── Support
│ │ │ ├── Converter
│ │ │ │ ├── IMessageConverter.cs
│ │ │ │ ├── ITypeMapper.cs
│ │ │ │ ├── MessageConversionException.cs
│ │ │ │ ├── SimpleMessageConverter.cs
│ │ │ │ ├── TypeMapper.cs
│ │ │ │ └── XmlMessageConverter.cs
│ │ │ ├── Destinations
│ │ │ │ ├── DynamicDestinationResolver.cs
│ │ │ │ ├── IDestinationResolver.cs
│ │ │ │ └── NmsDestinationAccessor.cs
│ │ │ ├── MessageUtils.cs
│ │ │ └── NmsAccessor.cs
│ │ ├── Properties
│ │ ├── Spring.Messaging.Nms.2003.csproj
│ │ ├── Spring.Messaging.Nms.2005.csproj
│ │ ├── Spring.Messaging.Nms.2008.csproj
│ │ ├── Spring.Messaging.Nms.2010.csproj
│ │ ├── Spring.Messaging.Nms.build
│ │ ├── Spring.Messaging.Nms.nuspec
│ │ └── Spring.Messaging.Nms.xml
│ ├── Spring.Scheduling.Quartz
│ │ ├── JobMethodInvocationFailedException.cs
│ │ ├── Scheduling
│ │ │ └── Quartz
│ │ │ ├── AdaptableJobFactory.cs
│ │ │ ├── CronTriggerObject.cs
│ │ │ ├── DelegatingJob.cs
│ │ │ ├── IJobDetailAwareTrigger.cs
│ │ │ ├── ISchedulerContextAware.cs
│ │ │ ├── ISchedulingTaskExecutor.cs
│ │ │ ├── ITaskExecutor.cs
│ │ │ ├── JobDetailObject.cs
│ │ │ ├── LocalDataSourceJobStore.cs
│ │ │ ├── LocalTaskExecutorThreadPool.cs
│ │ │ ├── MethodInvokingJob.cs
│ │ │ ├── MethodInvokingJobDetailFactoryObject.cs
│ │ │ ├── MethodInvokingRunnable.cs
│ │ │ ├── QuartzJobObject.cs
│ │ │ ├── ResourceJobSchedulingDataProcessor.cs
│ │ │ ├── SchedulerAccessor.cs
│ │ │ ├── SchedulerAccessorObject.cs
│ │ │ ├── SchedulerFactoryObject.cs
│ │ │ ├── SchedulingException.cs
│ │ │ ├── SimpleThreadPoolTaskExecutor.cs
│ │ │ ├── SimpleTriggerObject.cs
│ │ │ ├── SpringDbProviderAdapter.cs
│ │ │ ├── SpringObjectJobFactory.cs
│ │ │ ├── StatefulMethodInvokingJob.cs
│ │ │ └── TaskRejectedException.cs
│ │ ├── Spring.Scheduling.Quartz.2003.csproj
│ │ ├── Spring.Scheduling.Quartz.2005.csproj
│ │ ├── Spring.Scheduling.Quartz.2008.csproj
│ │ ├── Spring.Scheduling.Quartz.2010.csproj
│ │ ├── Spring.Scheduling.Quartz.build
│ │ └── Spring.Scheduling.Quartz.nuspec
│ ├── Spring.Services
│ │ ├── AssemblyInfo.cs
│ │ ├── EnterpriseServices
│ │ │ ├── EnterpriseServicesExporter.cs
│ │ │ ├── EnterpriseServices.keys
│ │ │ ├── ExeConfigurationSystem.cs
│ │ │ ├── ServicedComponentContextHandler.cs
│ │ │ ├── ServicedComponentExporter.cs
│ │ │ ├── ServicedComponentFactory.cs
│ │ │ └── ServicedComponentHelper.cs
│ │ ├── Remoting
│ │ │ ├── CaoExporter.cs
│ │ │ ├── CaoFactoryObject.cs
│ │ │ ├── Config
│ │ │ │ ├── RemotingNamespaceParser.cs
│ │ │ │ ├── spring-remoting-1.1.xsd
│ │ │ │ └── spring-remoting-1.1.xsx
│ │ │ ├── RemoteObjectFactory.cs
│ │ │ ├── RemotingConfigurer.cs
│ │ │ ├── SaoExporter.cs
│ │ │ ├── SaoFactoryObject.cs
│ │ │ └── Support
│ │ │ ├── BaseRemoteObject.cs
│ │ │ ├── ConfigurableLifetime.cs
│ │ │ ├── ICaoRemoteFactory.cs
│ │ │ ├── ILifetime.cs
│ │ │ └── RemoteObjectProxyTypeBuilder.cs
│ │ ├── ServiceModel
│ │ │ ├── Activation
│ │ │ │ ├── ServiceHostFactory.cs
│ │ │ │ ├── ServiceHostFactoryObject.cs
│ │ │ │ └── WebServiceHostFactory.cs
│ │ │ ├── ChannelFactoryObject.cs
│ │ │ ├── Config
│ │ │ │ ├── ChannelFactoryObjectDefinitionParser.cs
│ │ │ │ ├── spring-wcf-1.3.xsd
│ │ │ │ └── WcfNamespaceParser.cs
│ │ │ ├── ServiceExporter.cs
│ │ │ ├── SpringServiceHost.cs
│ │ │ ├── SpringWebServiceHost.cs
│ │ │ └── Support
│ │ │ └── ServiceProxyTypeBuilder.cs
│ │ ├── Spring.Services.2003.csproj
│ │ ├── Spring.Services.2005.csproj
│ │ ├── Spring.Services.2008.csproj
│ │ ├── Spring.Services.2010.csproj
│ │ ├── Spring.Services.build
│ │ ├── Spring.Services.nuspec
│ │ ├── Spring.Services.xml
│ │ └── Web
│ │ └── Services
│ │ └── WebServiceProxyFactory.cs
│ ├── Spring.Template.Velocity
│ │ ├── Spring.Template.Velocity.2008.csproj
│ │ ├── Spring.Template.Velocity.2010.csproj
│ │ ├── Spring.Template.Velocity.build
│ │ ├── Spring.Template.Velocity.nuspec
│ │ └── Template
│ │ └── Velocity
│ │ ├── CommonsLoggingLogSystem.cs
│ │ ├── Config
│ │ │ ├── spring-nvelocity-1.3.xsd
│ │ │ └── TemplateNamespaceParser.cs
│ │ ├── SpringResourceLoader.cs
│ │ ├── VelocityConstants.cs
│ │ ├── VelocityEngineFactory.cs
│ │ ├── VelocityEngineFactoryObject.cs
│ │ └── VelocityEngineUtils.cs
│ ├── Spring.Testing.Microsoft
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.Testing.Microsoft.2008.csproj
│ │ ├── Spring.Testing.Microsoft.2010.csproj
│ │ ├── Spring.Testing.Microsoft.build
│ │ ├── Spring.Testing.Microsoft.nuspec
│ │ └── Testing
│ │ └── Microsoft
│ │ ├── AbstractDependencyInjectionSpringContextTests.cs
│ │ ├── AbstractSpringContextTests.cs
│ │ ├── AbstractTransactionalDbProviderSpringContextTests.cs
│ │ └── AbstractTransactionalSpringContextTests.cs
│ ├── Spring.Testing.NUnit
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.Testing.NUnit.2003.csproj
│ │ ├── Spring.Testing.NUnit.2005.csproj
│ │ ├── Spring.Testing.NUnit.2008.csproj
│ │ ├── Spring.Testing.NUnit.2010.csproj
│ │ ├── Spring.Testing.NUnit.build
│ │ ├── Spring.Testing.NUnit.nuspec
│ │ ├── Spring.Testing.NUnit.xml
│ │ └── Testing
│ │ ├── Ado
│ │ │ ├── IPlatformTransaction.cs
│ │ │ └── SimpleAdoTestUtils.cs
│ │ └── NUnit
│ │ ├── AbstractDependencyInjectionSpringContextTests.cs
│ │ ├── AbstractSpringContextTests.cs
│ │ ├── AbstractTransactionalDbProviderSpringContextTests.cs
│ │ └── AbstractTransactionalSpringContextTests.cs
│ ├── Spring.Web
│ │ ├── AssemblyInfo.cs
│ │ ├── Caching
│ │ │ └── AspNetCache.cs
│ │ ├── Context
│ │ │ └── Support
│ │ │ ├── HttpApplicationConfigurer.cs
│ │ │ ├── WebApplicationContextArgs.cs
│ │ │ ├── WebApplicationContext.cs
│ │ │ ├── WebContextHandler.cs
│ │ │ └── WebSupportModule.cs
│ │ ├── Core
│ │ │ └── IO
│ │ │ └── WebResource.cs
│ │ ├── DataBinding
│ │ │ ├── DataSourceItemFormatter.cs
│ │ │ ├── HttpRequestBindingContainer.cs
│ │ │ ├── IBindingAwareFormatter.cs
│ │ │ ├── IWebDataBound.cs
│ │ │ └── MultipleSelectionListControlBinding.cs
│ │ ├── Globalization
│ │ │ ├── AspNetResourceCache.cs
│ │ │ └── Resolvers
│ │ │ ├── CookieCultureResolver.cs
│ │ │ ├── DefaultWebCultureResolver.cs
│ │ │ ├── RequestCultureResolver.cs
│ │ │ └── SessionCultureResolver.cs
│ │ ├── Objects
│ │ │ └── Factory
│ │ │ ├── Support
│ │ │ │ ├── ChildWebObjectDefinition.cs
│ │ │ │ ├── IWebObjectDefinition.cs
│ │ │ │ ├── IWebObjectNameGenerator.cs
│ │ │ │ ├── RootWebObjectDefinition.cs
│ │ │ │ ├── WebInstantiationStrategy.cs
│ │ │ │ ├── WebObjectDefinitionFactory.cs
│ │ │ │ ├── WebObjectFactory.cs
│ │ │ │ └── WebObjectUtils.cs
│ │ │ └── Xml
│ │ │ ├── WebObjectDefinitionDocumentReader.cs
│ │ │ ├── WebObjectDefinitionParserHelper.cs
│ │ │ ├── WebObjectDefinitionReader.cs
│ │ │ └── WebObjectsNamespaceParser.cs
│ │ ├── Spring.Web.2003.csproj
│ │ ├── Spring.Web.2005.csproj
│ │ ├── Spring.Web.2008.csproj
│ │ ├── Spring.Web.2010.csproj
│ │ ├── Spring.Web.build
│ │ ├── Spring.Web.nuspec
│ │ ├── Spring.Web.xml
│ │ ├── Threading
│ │ │ ├── HttpContextStorage.cs
│ │ │ └── HybridContextStorage.cs
│ │ ├── Util
│ │ │ ├── HttpContextSwitch.cs
│ │ │ ├── ISessionState.cs
│ │ │ ├── IVirtualEnvironment.cs
│ │ │ ├── SecurityCritical.cs
│ │ │ ├── VirtualEnvironment.cs
│ │ │ └── WebUtils.cs
│ │ └── Web
│ │ ├── Providers
│ │ │ ├── ConfigurableActiveDirectoryMembershipProvider.cs
│ │ │ ├── ConfigurableSqlMembershipProvider.cs
│ │ │ ├── ConfigurableSqlProfileProvider.cs
│ │ │ ├── ConfigurableSqlRoleProvider.cs
│ │ │ ├── ConfigurableXmlSiteMapProvider.cs
│ │ │ ├── IMembershipProvider.cs
│ │ │ ├── IProfileProvider.cs
│ │ │ ├── IRoleProvider.cs
│ │ │ ├── ISiteMapProvider.cs
│ │ │ ├── MembershipProviderAdapter.cs
│ │ │ ├── ProfileProviderAdapter.cs
│ │ │ ├── RoleProviderAdapter.cs
│ │ │ └── SiteMapProviderAdapter.cs
│ │ ├── Services
│ │ │ ├── WebServiceExporter.cs
│ │ │ └── WebServiceHandlerFactory.cs
│ │ ├── Support
│ │ │ ├── AbstractHandlerFactory.cs
│ │ │ ├── ContextMonitor.cs
│ │ │ ├── ControlAccessor.cs
│ │ │ ├── ControlCollectionAccessor.cs
│ │ │ ├── ControlInterceptor.cs
│ │ │ ├── DefaultHandlerFactory.cs
│ │ │ ├── DefaultResultFactory.cs
│ │ │ ├── DefaultResultWebNavigator.cs
│ │ │ ├── HandlerMap.cs
│ │ │ ├── HandlerMapEntry.cs
│ │ │ ├── IHierarchicalWebNavigator.cs
│ │ │ ├── IInterceptionStrategy.cs
│ │ │ ├── InterceptControlCollectionOwnerStrategy.cs
│ │ │ ├── InterceptControlCollectionStrategy.cs
│ │ │ ├── IResult.cs
│ │ │ ├── IResultFactory.cs
│ │ │ ├── IResultWebNavigator.cs
│ │ │ ├── ISupportsWebDependencyInjection.cs
│ │ │ ├── IWebNavigable.cs
│ │ │ ├── IWebNavigator.cs
│ │ │ ├── LocalResourceManager.cs
│ │ │ ├── MappingHandlerFactoryConfigurer.cs
│ │ │ ├── MappingHandlerFactory.cs
│ │ │ ├── MimeMediaType.cs
│ │ │ ├── PageHandlerFactory.cs
│ │ │ ├── Result.cs
│ │ │ ├── ResultFactoryRegistry.cs
│ │ │ ├── ResultMode.cs
│ │ │ ├── Script.cs
│ │ │ ├── SharedStateResourceCache.cs
│ │ │ ├── SupportsWebDependencyInjectionMethodBuilder.cs
│ │ │ ├── SupportsWebDependencyInjectionOwnerProxy.cs
│ │ │ ├── SupportsWebDependencyInjectionTypeBuilder.cs
│ │ │ ├── WebDependencyInjectionUtils.cs
│ │ │ ├── WebFormsResultWebNavigator.cs
│ │ │ └── WebNavigableWebNavigatorAdapter.cs
│ │ └── UI
│ │ ├── AbstractWizard.cs
│ │ ├── Controls
│ │ │ ├── AbstractBaseValidator.cs
│ │ │ ├── AbstractValidationControl.cs
│ │ │ ├── Calendar.cs
│ │ │ ├── CheckBoxList.cs
│ │ │ ├── CheckBoxValidator.cs
│ │ │ ├── Content.cs
│ │ │ ├── ContentPlaceholder.cs
│ │ │ ├── ContentReplacer.cs
│ │ │ ├── ControlState.cs
│ │ │ ├── DataBindingAdapter.cs
│ │ │ ├── DataBindingPanel.cs
│ │ │ ├── Form.cs
│ │ │ ├── Head.cs
│ │ │ ├── LocalizedImage.cs
│ │ │ ├── MultiView.cs
│ │ │ ├── Panel.cs
│ │ │ ├── RadioButtonGroup.cs
│ │ │ ├── TabCommandEventArgs.cs
│ │ │ ├── TabCommandEventHandler.cs
│ │ │ ├── TabContainer.cs
│ │ │ ├── TabularMultiView.cs
│ │ │ ├── TabularViewCollection.cs
│ │ │ ├── TabularView.cs
│ │ │ ├── ValidationError.cs
│ │ │ ├── ValidationSummary.cs
│ │ │ ├── ViewCollection.cs
│ │ │ └── View.cs
│ │ ├── DialogAttribute.cs
│ │ ├── IModelPersistenceMedium.cs
│ │ ├── IValidationContainer.cs
│ │ ├── MasterPage.cs
│ │ ├── Page.cs
│ │ ├── SessionModelPersistenceMedium.cs
│ │ ├── UserControl.cs
│ │ └── Validation
│ │ ├── AbstractValidationErrorsRenderer.cs
│ │ ├── DivValidationErrorsRenderer.cs
│ │ ├── IconValidationErrorsRenderer.cs
│ │ ├── IValidationErrorsRenderer.cs
│ │ └── SpanValidationErrorsRenderer.cs
│ ├── Spring.Web.Extensions
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.Web.Extensions.2005.csproj
│ │ ├── Spring.Web.Extensions.2008.csproj
│ │ ├── Spring.Web.Extensions.2010.csproj
│ │ ├── Spring.Web.Extensions.build
│ │ ├── Spring.Web.Extensions.nuspec
│ │ ├── Spring.Web.Extensions.xml
│ │ └── Web
│ │ └── Script
│ │ └── Services
│ │ └── ScriptHandlerFactory.cs
│ ├── Spring.Web.Mvc
│ │ ├── Context
│ │ │ └── Support
│ │ │ ├── MvcApplicationContextArgs.cs
│ │ │ ├── MvcApplicationContext.cs
│ │ │ └── MvcContextHandler.cs
│ │ ├── Properties
│ │ ├── SpringActionInvoker.cs
│ │ ├── SpringControllerFactory.cs
│ │ ├── SpringMvcApplication.cs
│ │ ├── Spring.Web.Mvc.2010.csproj
│ │ ├── Spring.Web.Mvc.build
│ │ ├── Spring.Web.Mvc.nuspec
│ │ └── Spring.Web.Mvc.xml
│ └── Spring.Web.Mvc3
│ ├── Context
│ │ └── Support
│ │ ├── MvcApplicationContextArgs.cs
│ │ ├── MvcApplicationContext.cs
│ │ └── MvcContextHandler.cs
│ ├── Properties
│ ├── SpringMvcApplication.cs
│ ├── SpringMvcDependencyResolver.cs
│ ├── Spring.Web.Mvc3.2010.csproj
│ ├── Spring.Web.Mvc3.build
│ ├── Spring.Web.Mvc3.nuspec
│ └── Spring.Web.Mvc3.xml
└── test
└── Spring
├── CommonAssemblyInfo.cs
├── Spring.Aop.Tests
│ ├── Aop
│ │ ├── Advice
│ │ │ └── DebugAdvice.cs
│ │ ├── Config
│ │ │ ├── AopNamespaceParserTests.cs
│ │ │ └── AopNamespaceParserTests.xml
│ │ ├── Framework
│ │ │ ├── AbstractMethodInvocationTests.cs
│ │ │ ├── Adapter
│ │ │ │ ├── AdvisorAdapterRegistrationTests.cs
│ │ │ │ ├── AfterReturningAdviceInterceptorTests.cs
│ │ │ │ ├── ThrowsAdviceInterceptorTests.cs
│ │ │ │ └── UnknownAdviceTypeExceptionTests.cs
│ │ │ ├── AopContextTests.cs
│ │ │ ├── AutoProxy
│ │ │ │ ├── AbstractAdvisorAutoProxyCreatorTests.cs
│ │ │ │ ├── AbstractAutoProxyCreatorTests.cs
│ │ │ │ ├── AdvisorAutoProxyCreatorCircularReferencesTests.cs
│ │ │ │ ├── advisorAutoProxyCreatorCircularReferencesTests.xml
│ │ │ │ ├── AdvisorAutoProxyCreatorTests.cs
│ │ │ │ ├── AttributeAutoProxyCreatorTests.cs
│ │ │ │ ├── CreatesTestObject.cs
│ │ │ │ ├── DefaultAdvisorAutoProxyCreatorTests.cs
│ │ │ │ ├── InfrastructureAdvisorAutoProxyCreator.cs
│ │ │ │ ├── LogicalThreadContextAdvice.cs
│ │ │ │ ├── NoSetterProperties.cs
│ │ │ │ ├── ObjectNameAutoProxyCreatorTests.cs
│ │ │ │ ├── OrderedLogicalThreadContextCheckAdvisor.cs
│ │ │ │ ├── PointcutFilteringAutoProxyCreatorTests.cs
│ │ │ │ └── TypeNameAutoProxyCreatorTests.cs
│ │ │ ├── CountingAfterReturningAdvice.cs
│ │ │ ├── CountingBeforeAdvice.cs
│ │ │ ├── CountingMultiAdvice.cs
│ │ │ ├── CountingThrowsAdvice.cs
│ │ │ ├── DynamicMethodInvocationTests.cs
│ │ │ ├── DynamicProxy
│ │ │ │ ├── AbstractAopProxyTests.cs
│ │ │ │ ├── AopUtilsTests.cs
│ │ │ │ ├── CachedAopProxyFactoryTests.cs
│ │ │ │ ├── CompositionAopProxyTests.cs
│ │ │ │ ├── DecoratorAopProxyTests.cs
│ │ │ │ ├── DefaultAopProxyFactoryTests.cs
│ │ │ │ ├── InheritanceAopProxyTests.cs
│ │ │ │ └── MockTargetSource.cs
│ │ │ ├── HashtableCachingAdvisorChainFactoryTests.cs
│ │ │ ├── IIsModified.cs
│ │ │ ├── IsModifiedMixin.cs
│ │ │ ├── ITimeStamped.cs
│ │ │ ├── MethodCounter.cs
│ │ │ ├── PrototypeTargetTests.cs
│ │ │ ├── ProxyConfigTests.cs
│ │ │ ├── ProxyFactoryObjectTests.cs
│ │ │ ├── ProxyFactoryTests.cs
│ │ │ ├── ReflectiveMethodInvocationTests.cs
│ │ │ ├── TimestampIntroductionInterceptor.cs
│ │ │ └── UnsupportedInterceptor.cs
│ │ ├── Interceptor
│ │ │ ├── NopInterceptor.cs
│ │ │ └── SerializableNopInterceptor.cs
│ │ ├── ISimpleBeforeAdvice.cs
│ │ ├── SimpleBeforeAdviceAdapter.cs
│ │ ├── SimpleBeforeAdviceImpl.cs
│ │ ├── SimpleBeforeAdviceInterceptor.cs
│ │ ├── Support
│ │ │ ├── AbstractRegularExpressionMethodPointcutTests.cs
│ │ │ ├── AttributeMatchMethodPointcutTests.cs
│ │ │ ├── ControlFlowPointcutTests.cs
│ │ │ ├── DefaultIntroductionAdvisorTests.cs
│ │ │ ├── DelegatingIntroductionInterceptorTests.cs
│ │ │ ├── RegularExpressionMethodPointcutAdvisorTests.cs
│ │ │ ├── RootTypeFilterTests.cs
│ │ │ ├── SdkRegularExpressionMethodPointcutTests.cs
│ │ │ └── TypeFiltersTests.cs
│ │ ├── Target
│ │ │ ├── EmptyTargetSourceTests.cs
│ │ │ ├── HotSwappableTargetSourceTests.cs
│ │ │ ├── PrototypeTargetSourceTests.cs
│ │ │ ├── SimplePoolTargetSourceTests.cs
│ │ │ ├── SingletonTargetSourceTests.cs
│ │ │ └── ThreadLocalTargetSourceTests.cs
│ │ ├── TrueMethodMatcherTests.cs
│ │ ├── TruePointcutTests.cs
│ │ └── TrueTypeFilterTests.cs
│ ├── AopCompilerOptionsTests.cs
│ ├── AopExceptionTests.cs
│ ├── AopSerializationTests.cs
│ ├── Aspects
│ │ ├── Cache
│ │ │ ├── CacheAspectIntegrationTests.cs
│ │ │ ├── CacheParameterAdviceTests.cs
│ │ │ ├── CacheResultAdviceTests.cs
│ │ │ └── InvalidateCacheAdviceTests.cs
│ │ ├── Exception
│ │ │ ├── CaptureOutputLogger.cs
│ │ │ ├── CaptureOutputLoggerFactoryAdapter.cs
│ │ │ └── ExceptionHandlerAspectIntegrationTests.cs
│ │ ├── Logging
│ │ │ ├── SimpleLoggingAdviceTests.cs
│ │ │ └── TestableSimpleLoggingAdvice.cs
│ │ ├── RetryAdviceTests.cs
│ │ └── Validation
│ │ └── ParameterValidationAdviceTests.cs
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── Spring
│ │ └── Aop
│ │ ├── Framework
│ │ │ ├── adapter
│ │ │ │ ├── withBPPContext.xml
│ │ │ │ └── withoutBPPContext.xml
│ │ │ ├── AutoProxy
│ │ │ │ ├── advisorAutoProxyCreator.xml
│ │ │ │ └── objectNameAutoProxyCreatorTests.xml
│ │ │ ├── innerBeanTarget.xml
│ │ │ ├── prototypeTarget.xml
│ │ │ ├── prototypeTests.xml
│ │ │ ├── proxyFactoryDoubleTargetSourceTests.xml
│ │ │ ├── proxyFactoryTargetSourceTests.xml
│ │ │ ├── proxyFactoryTests.xml
│ │ │ ├── serializationTests.xml
│ │ │ └── throwsAdvice.xml
│ │ ├── Support
│ │ │ └── RegularExpressionSetterTests.xml
│ │ └── Target
│ │ ├── commonsPoolTests.xml
│ │ ├── hotSwapTests.xml
│ │ ├── prototypeTargetSourceTests.xml
│ │ ├── simplePoolTests.xml
│ │ └── threadLocalTests.xml
│ ├── Spring.Aop.Tests.2002.csproj
│ ├── Spring.Aop.Tests.2003.csproj
│ ├── Spring.Aop.Tests.2005.csproj
│ ├── Spring.Aop.Tests.2008.csproj
│ ├── Spring.Aop.Tests.2010.csproj
│ ├── Spring.Aop.Tests.build
│ └── Spring.Aop.Tests.dll.config
├── Spring.Core.Tests
│ ├── AssemblyInfo.cs
│ ├── Caching
│ │ ├── AbstractCacheTests.cs
│ │ └── BaseCacheAttributeTests.cs
│ ├── Collections
│ │ ├── AbstractQueueTests.cs
│ │ ├── CaseInsensitiveHashtableTests.cs
│ │ ├── Generic
│ │ │ └── ReadOnlyDictionaryTests.cs
│ │ ├── HashedSetTests.cs
│ │ ├── HybridSetTests.cs
│ │ ├── ImmutableSetTests.cs
│ │ ├── LinkedListTests.cs
│ │ ├── ListSetTests.cs
│ │ ├── PriorityQueueTests.cs
│ │ ├── SetTests.cs
│ │ ├── SortedSetTests.cs
│ │ ├── StaticSetTests.cs
│ │ └── SynchronizedHashtableTests.cs
│ ├── CommonTypes.cs
│ ├── CompilerOptionsTests.cs
│ ├── Context
│ │ ├── ApplicationEventArgsTests.cs
│ │ ├── CommonTypes.cs
│ │ ├── ContextExceptionTests.cs
│ │ ├── contextlifecycle.xml
│ │ ├── ContextListenerObject.cs
│ │ ├── EventListenerAttributeTests.cs
│ │ ├── Events
│ │ │ └── ConsoleListenerTests.cs
│ │ └── Support
│ │ ├── AbstractApplicationContextTests.cs
│ │ ├── AbstractMessageSourceTests.cs
│ │ ├── ApplicationContextAwareProcessorTests.cs
│ │ ├── ApplicationContextExtensionTests.cs
│ │ ├── ApplicationObjectSupportTests.cs
│ │ ├── Assembler.cs
│ │ ├── contextA.xml
│ │ ├── contextB.xml
│ │ ├── contextC.xml
│ │ ├── ContextLocatorHandlerTests.cs
│ │ ├── ContextRegistryTests.cs
│ │ ├── DefaultMessageSourceResolvableTests.cs
│ │ ├── DelegatingMessageSourceTests.cs
│ │ ├── import1.xml
│ │ ├── innerObjectsWithPostProcessor.xml
│ │ ├── invalidType.xml
│ │ ├── invalidValueType.xml
│ │ ├── Logic.cs
│ │ ├── MessageSourceAccessorTests.cs
│ │ ├── NamespaceParsersSectionHandlerTests.cs
│ │ ├── NullMessageSourceTests.cs
│ │ ├── objects.xml
│ │ ├── ResourceSetMessageSourceTests.cs
│ │ ├── Service.cs
│ │ ├── simpleContext.xml
│ │ ├── StaticApplicationContextTests.cs
│ │ ├── StaticMessageSourceTests.cs
│ │ ├── TestObjectConfigParser.cs
│ │ ├── testobject.xsd
│ │ ├── testobject.xsx
│ │ ├── TypeAliasesSectionHandlerTests.cs
│ │ ├── XmlApplicationContentArgsTests.cs
│ │ ├── XmlApplicationContextTests.cs
│ │ └── XmlApplicationContextTests-SPRNET1231.xml
│ ├── Core
│ │ ├── ComposedCriteriaTests.cs
│ │ ├── ControlFlowFactoryTests.cs
│ │ ├── IO
│ │ │ ├── AssemblyResourceTest.cs
│ │ │ ├── ConfigSectionResourceTests_config1.xml
│ │ │ ├── ConfigSectionResourceTests.cs
│ │ │ ├── ConfigurableResourceLoaderTests.cs
│ │ │ ├── EncodedResourceTests.cs
│ │ │ ├── FileSystemResourceCommonTests.cs
│ │ │ ├── FileSystemResourceTests.cs
│ │ │ ├── InputStreamResourceTests.cs
│ │ │ ├── ResourceConverterTests.cs
│ │ │ ├── ResourceHandlerRegistryTests.cs
│ │ │ ├── StringResourceTests.cs
│ │ │ ├── TestResource.txt
│ │ │ └── UrlResourceTest.cs
│ │ ├── MethodArgumentsCriteriaTests.cs
│ │ ├── MethodGenericArgumentsCountCriteriaTests.cs
│ │ ├── MethodParametersCountCriteriaTests.cs
│ │ ├── MethodParametersCriteriaTests.cs
│ │ ├── MethodReturnTypeCriteriaTests.cs
│ │ ├── OrderComparatorTests.cs
│ │ ├── RegularExpressionEventNameCriteriaTests.cs
│ │ ├── RegularExpressionMethodNameCriteriaTests.cs
│ │ ├── TypeConversion
│ │ │ ├── CredentialConverterTests.cs
│ │ │ ├── CustomNumberConverterTests.cs
│ │ │ ├── FileInfoConverterTests.cs
│ │ │ ├── NameValueConverterTests.cs
│ │ │ ├── RegexConverterTests.cs
│ │ │ ├── RegistryKeyConverterTests.cs
│ │ │ ├── ResourceManagerTests.cs
│ │ │ ├── RGBColorConverterTests.cs
│ │ │ ├── RuntimeTypeConverterTests.cs
│ │ │ ├── StreamConverterTests.cs
│ │ │ ├── StringArrayConverterTests.cs
│ │ │ ├── TimeSpanConverterTests.cs
│ │ │ ├── TypeConversionUtilsTests.cs
│ │ │ ├── TypeConverterRegistryTests.cs
│ │ │ ├── UniqueKeyConverterTests.cs
│ │ │ └── UriConverterTests.cs
│ │ └── TypeResolution
│ │ ├── aliasedObjects.xml
│ │ ├── CachedTypeResolverTests.cs
│ │ ├── GenericTypeResolverTests.cs
│ │ ├── TypeAssemblyHolderTests.cs
│ │ ├── TypeRegistryTests.cs
│ │ ├── TypeResolutionUtilsTests.cs
│ │ └── TypeResolverTests.cs
│ ├── CoreCompilerOptionsTests.cs
│ ├── CoreExceptionTests.cs
│ ├── Data
│ │ ├── PathMatcher
│ │ │ ├── EmptyPattern.test
│ │ │ ├── Examples.test
│ │ │ ├── InBetween.test
│ │ │ ├── MatchAll.test
│ │ │ ├── PatternsAreCaseSensitive.test
│ │ │ ├── SingleCaracters.test
│ │ │ ├── SlurpPrependedDirectories.test
│ │ │ ├── SpringAssembliesPrefix.test
│ │ │ └── ThisDirectory.test
│ │ └── Spring
│ │ ├── Context
│ │ │ └── Support
│ │ │ └── SPRNET-192.xml
│ │ └── Objects
│ │ └── Factory
│ │ ├── concurrent.xml
│ │ ├── Config
│ │ │ ├── AnotherDaoConfig.xml
│ │ │ ├── DaoConfig.xml
│ │ │ ├── DatabaseConfig.xml
│ │ │ ├── one.properties
│ │ │ ├── PPC-SPRNET-55.xml
│ │ │ ├── PPCTwoLocationsOneSectionTests.xml
│ │ │ ├── PPCTwoLocationsTwoSectionsTests.xml
│ │ │ ├── PPCWithTypesTests.xml
│ │ │ ├── PropertyPlaceholderConfigurerTests.xml
│ │ │ ├── PropertyResourceConfigurerTests.xml
│ │ │ ├── two.properties
│ │ │ └── TypeAliases.xml
│ │ ├── leaf.xml
│ │ ├── middle.xml
│ │ ├── root.xml
│ │ └── Xml
│ │ ├── abstract.xml
│ │ ├── array-autowire.xml
│ │ ├── autowire.xml
│ │ ├── bad-external-resources.xml
│ │ ├── bad-named-constructor-arg.xml
│ │ ├── child.xml
│ │ ├── classnotfound.xml
│ │ ├── collectionMergingGeneric.xml
│ │ ├── collectionMerging.xml
│ │ ├── collections.xml
│ │ ├── constructor-arg.xml
│ │ ├── ctor-args.xml
│ │ ├── default-autowire.xml
│ │ ├── default-lazy-init.xml
│ │ ├── dependenciesmaterializethis.xml
│ │ ├── enums.xml
│ │ ├── event-wiring-prototypes.xml
│ │ ├── event-wiring.xml
│ │ ├── expressions.xml
│ │ ├── external-resources.xml
│ │ ├── factorycircle.xml
│ │ ├── factory-methods.xml
│ │ ├── field-props-factory.xml
│ │ ├── initializers.xml
│ │ ├── invalid-factory.xml
│ │ ├── invalid.xml
│ │ ├── invoke-factory.xml
│ │ ├── lazy-init-multithreaded.xml
│ │ ├── locale.xml
│ │ ├── no-objects.xml
│ │ ├── notfullyspecified.xml
│ │ ├── objectNameGeneration.xml
│ │ ├── parent.xml
│ │ ├── reftypes.xml
│ │ ├── Resources
│ │ │ └── resource-imports.xml
│ │ ├── resource.xml
│ │ ├── satisfiedalldependencycheck.xml
│ │ ├── satisfiedobjectdependencycheck.xml
│ │ ├── satisfiedsimpledependencycheck.xml
│ │ ├── schema-validation.xml
│ │ ├── simple-constructor-arg.xml
│ │ ├── test.xml
│ │ ├── unsatisfiedalldependencycheckmissingobjects.xml
│ │ ├── unsatisfiedAllDependencyCheckMissingSimple.xml
│ │ ├── unsatisfiedobjectdependencycheck.xml
│ │ ├── unsatisfiedsimpledependencycheck.xml
│ │ └── wellformed-but-bad.xml
│ ├── DataBinding
│ │ ├── BaseBindingManagerTests.cs
│ │ └── SimpleExpressionBindingTests.cs
│ ├── ExceptionsTest.cs
│ ├── Expressions
│ │ ├── ConstructorNodeTests.cs
│ │ ├── ExpressionEvaluatorTests.cs
│ │ ├── FunctionNodeTests.cs
│ │ ├── MethodNodeTests.cs
│ │ ├── OpADDTests.cs
│ │ ├── OpANDTests.cs
│ │ ├── OpORTests.cs
│ │ ├── OpXORTests.cs
│ │ ├── Processors
│ │ │ ├── ConversionProcessorTests.cs
│ │ │ └── OrderByProcessorTests.cs
│ │ ├── PropertyOrFieldNodeTests.cs
│ │ ├── ReferenceNodeTests.cs
│ │ └── SelectionNodeTests.cs
│ ├── Globalization
│ │ ├── AbstractLocalizerTests.cs
│ │ ├── CultureInfoUtils.cs
│ │ ├── CultureTestScope.cs
│ │ ├── Formatters
│ │ │ ├── BooleanFormatterTests.cs
│ │ │ ├── CurrencyFormatterTests.cs
│ │ │ ├── DateTimeFormatterTests.cs
│ │ │ ├── FilteringFormatterTests.cs
│ │ │ ├── FloatFormatterTests.cs
│ │ │ ├── HasTextFilteringFormatterTests.cs
│ │ │ ├── IntegerFormatterTests.cs
│ │ │ ├── NumberFormatterTests.cs
│ │ │ └── PercentFormatterTests.cs
│ │ ├── Localizers
│ │ │ └── ResourceSetLocalizerTests.cs
│ │ └── Resolvers
│ │ └── DefaultCultureResolverTests.cs
│ ├── HookableContextHandler.cs
│ ├── Objects
│ │ ├── DerivedTestObject.cs
│ │ ├── Events
│ │ │ └── Support
│ │ │ ├── EventManipulationUtilsTests.cs
│ │ │ └── EventRegistryTests.cs
│ │ ├── ExpressionTestObject.cs
│ │ ├── Factory
│ │ │ ├── AbstractListableObjectFactoryTests.cs
│ │ │ ├── AbstractObjectFactoryTests.cs
│ │ │ ├── Attributes
│ │ │ │ ├── MyRequiredAttribute.cs
│ │ │ │ ├── RequiredAttributeObjectPostProcessorTests.cs
│ │ │ │ ├── RequiredTestObject.cs
│ │ │ │ ├── RequiredWithAllRequiredPropertiesProvided.xml
│ │ │ │ ├── RequiredWithCustomAttribute.xml
│ │ │ │ ├── RequiredWithOneRequiredPropertyOmitted.xml
│ │ │ │ └── RequiredWithThreeRequiredPropertiesOmitted.xml
│ │ │ ├── ConcurrentObjectFactoryTests.cs
│ │ │ ├── Config
│ │ │ │ ├── AbstractFactoryObjectTests.cs
│ │ │ │ ├── CommandLineArgsVariableSourceTests.cs
│ │ │ │ ├── ConfigSectionVariableSourceTests.cs
│ │ │ │ ├── ConfigurableVariableSourceTests.cs
│ │ │ │ ├── ConfigurationReaderTests.cs
│ │ │ │ ├── ConnectionStringsVariableSourceTests.cs
│ │ │ │ ├── ConstructorArgumentValuesTests.cs
│ │ │ │ ├── CustomConverterConfigurerTests.cs
│ │ │ │ ├── DelegateFactoryObjectTests.cs
│ │ │ │ ├── DelegateObjectFactoryConfigurerTests.cs
│ │ │ │ ├── DictionaryFactoryObjectTests.cs
│ │ │ │ ├── DictionaryVariableSourceTests.cs
│ │ │ │ ├── EnvironmentVariableSourceTests.cs
│ │ │ │ ├── EventValuesTests.cs
│ │ │ │ ├── FieldRetrievingFactoryObjectTests.cs
│ │ │ │ ├── ListFactoryObjectTests.cs
│ │ │ │ ├── LogFactoryObjectTests.cs
│ │ │ │ ├── MethodInvokingFactoryObjectTests.cs
│ │ │ │ ├── ObjectDefinitionVisitorTests.cs
│ │ │ │ ├── ObjectFactoryCreatingFactoryObjectTests.cs
│ │ │ │ ├── ObjectReferenceFactoryObjectTests.cs
│ │ │ │ ├── PropertyFileVariableSourceTests.cs
│ │ │ │ ├── PropertyOverrideConfigurerTests.cs
│ │ │ │ ├── PropertyPathFactoryObjectTests.cs
│ │ │ │ ├── PropertyPlaceholderConfigurerTests.cs
│ │ │ │ ├── PropertyRetrievingFactoryObjectTests.cs
│ │ │ │ ├── RegistryVariableSourceTests.cs
│ │ │ │ ├── ResourceHandlerConfigurerTests.cs
│ │ │ │ ├── ResourceManagerFactoryObjectTests.cs
│ │ │ │ ├── RuntimeObjectReferenceTests.cs
│ │ │ │ ├── SetFactoryObjectTests.cs
│ │ │ │ ├── SharedStateAwareProcessorTests.cs
│ │ │ │ ├── SpecialFolderVariableSourceTests.cs
│ │ │ │ ├── TypeAliasConfigurerTests.cs
│ │ │ │ ├── TypedStringValueTests.cs
│ │ │ │ ├── VariableAccessorTests.cs
│ │ │ │ └── VariablePlaceholderConfigurerTests.cs
│ │ │ ├── DefaultListableObjectFactoryPerfTests.cs
│ │ │ ├── DefaultListableObjectFactoryTests.cs
│ │ │ ├── DummyConfigurableFactory.cs
│ │ │ ├── DummyFactory.cs
│ │ │ ├── HasMap.cs
│ │ │ ├── ISideEffectObject.cs
│ │ │ ├── KnowsIfInstantiated.cs
│ │ │ ├── LifecycleObject.cs
│ │ │ ├── MethodReplacerTests.cs
│ │ │ ├── MustBeInitialized.cs
│ │ │ ├── NoSuchObjectDefinitionExceptionTests.cs
│ │ │ ├── ObjectDefinitionStoreExceptionTests.cs
│ │ │ ├── ObjectFactoryUtilsTests.cs
│ │ │ ├── SideEffectObject.cs
│ │ │ ├── Support
│ │ │ │ ├── AutowireUtilsTests.cs
│ │ │ │ ├── ChildObjectDefinitionTests.cs
│ │ │ │ ├── DefaultObjectDefinitionFactoryTests.cs
│ │ │ │ ├── DelegatingMethodReplacerTests.cs
│ │ │ │ ├── LookupMethodOverrideTests.cs
│ │ │ │ ├── LookupMethodReplacerTests.cs
│ │ │ │ ├── ManagedDictionaryTests.cs
│ │ │ │ ├── ManagedListTests.cs
│ │ │ │ ├── ManagedNameValueCollectionTests.cs
│ │ │ │ ├── ManagedSetTests.cs
│ │ │ │ ├── ObjectDefinitionBuilderTests.cs
│ │ │ │ ├── ObjectDefinitionReaderUtilsTests.cs
│ │ │ │ ├── ReplacedMethodOverrideTests.cs
│ │ │ │ ├── RootObjectDefinitionTests.cs
│ │ │ │ └── SimpleInstantiationStrategyTests.cs
│ │ │ ├── TestResource.txt
│ │ │ ├── UnsupportedObjectDefinitionImplementation.cs
│ │ │ └── Xml
│ │ │ ├── ArrayCtorDependencyObject.cs
│ │ │ ├── CollectionMergingGenericTests.cs
│ │ │ ├── CollectionMergingTests.cs
│ │ │ ├── ConstructorDependenciesObject.cs
│ │ │ ├── DependenciesObject.cs
│ │ │ ├── DerivedConstructorDependenciesObject.cs
│ │ │ ├── DoubleBooleanConstructorObject.cs
│ │ │ ├── DummyBo.cs
│ │ │ ├── DummyDao.cs
│ │ │ ├── DummyReferencer.cs
│ │ │ ├── EventWiringTests.cs
│ │ │ ├── FactoryMethods.cs
│ │ │ ├── IDummyBo.cs
│ │ │ ├── InstanceFactory.cs
│ │ │ ├── LocaleTests.cs
│ │ │ ├── MixedCollectionObject.cs
│ │ │ ├── NamespaceParserRegistryTests.cs
│ │ │ ├── NamespaceParserRegistryTests_TestSchema_2.xsd
│ │ │ ├── NamespaceParserRegistryTests_TestSchema.xsd
│ │ │ ├── NullAppender.cs
│ │ │ ├── ObjectFactorySectionHandlerTests.cs
│ │ │ ├── ObjectNameGenerationTests.cs
│ │ │ ├── ReadOnlyXmlTestResource.cs
│ │ │ ├── SiimpleCtorWiringTests.cs
│ │ │ ├── SingleSimpleTypeConstructorObject.cs
│ │ │ ├── TestObjectCreator.cs
│ │ │ ├── XmlListableObjectFactoryTests.cs
│ │ │ ├── XmlObjectCollectionTests.cs
│ │ │ ├── XmlObjectDefinitionReaderTests.cs
│ │ │ ├── XmlObjectDefinitionReaderTests_CustomSchema.xsd
│ │ │ ├── XmlObjectFactoryTests.cs
│ │ │ └── XmlParserResolverTests.cs
│ │ ├── IndexedTestObject.cs
│ │ ├── INestedTestObject.cs
│ │ ├── IOther.cs
│ │ ├── IPerson.cs
│ │ ├── ITestObject.cs
│ │ ├── LazyTestObject.cs
│ │ ├── MutablePropertyValuesTests.cs
│ │ ├── NestedTestObject.cs
│ │ ├── NotWritablePropertyExceptionTests.cs
│ │ ├── NumberTestObject.cs
│ │ ├── ObjectWrapperTests.cs
│ │ ├── PropertyAccessExceptionsExceptionTests.cs
│ │ ├── PropertyValueTests.cs
│ │ ├── ResourceTestObject.cs
│ │ ├── SerializablePerson.cs
│ │ ├── StaticTestEventHandler.cs
│ │ ├── Support
│ │ │ ├── AbstractSharedStateFactoryTests.cs
│ │ │ ├── ArgumentConvertingMethodInvokerTests.cs
│ │ │ ├── AutoWiringEventHandlerValueTests.cs
│ │ │ ├── ByTypeSharedStateProviderTests.cs
│ │ │ ├── InstanceEventHandlerValueTests.cs
│ │ │ ├── MethodInvokerTests.cs
│ │ │ ├── MutableSortDefinitionTests.cs
│ │ │ ├── PropertyComparatorTests.cs
│ │ │ └── StaticEventHandlerValueTests.cs
│ │ ├── TestEventHandler.cs
│ │ ├── TestGenericObject.cs
│ │ ├── TestObject.cs
│ │ ├── TestObjectDAO.cs
│ │ ├── TestObjectList.cs
│ │ ├── TestObject.resx
│ │ ├── TestTransparentProxyFactory.cs
│ │ ├── TypeMismatchExceptionTests.cs
│ │ └── ValidatorTestObject.cs
│ ├── Pool
│ │ └── Support
│ │ └── SimplePoolTest.cs
│ ├── Proxy
│ │ ├── AbstractProxyTypeBuilderTests.cs
│ │ ├── CompositionProxyTypeBuilderTests.cs
│ │ ├── DynamicProxyManagerTests.cs
│ │ ├── ExplicitCompositionProxyTypeBuilderTests.cs
│ │ └── InheritanceProxyTypeBuilderTests.cs
│ ├── Reflection
│ │ └── Dynamic
│ │ ├── BasePropertyTests.cs
│ │ ├── DynamicConstructorTests.cs
│ │ ├── DynamicFieldTests.cs
│ │ ├── DynamicIndexerTests.cs
│ │ ├── DynamicMethodTests.cs
│ │ ├── DynamicPropertyTests.cs
│ │ ├── SafeFieldTests.cs
│ │ ├── SafePropertyTests.cs
│ │ └── SafePropertyTests_TestObject.vb
│ ├── Resources
│ │ ├── Images.resx
│ │ ├── SampleResources.resx
│ │ ├── SimpleAppContext.xml
│ │ ├── Spring.Context.Tests.de-AT.resx
│ │ ├── Spring.Context.Tests.de.resx
│ │ ├── Spring.Context.Tests.pt-BR.resx
│ │ ├── Spring.Context.Tests.resx
│ │ ├── Spring.Context.Tests.sr-Cyrl-CS.resx
│ │ ├── Spring.Context.Tests.sr.resx
│ │ ├── Spring.Context.Tests.sr-SP-Cyrl.resx
│ │ ├── Tesla.resx
│ │ ├── Tesla.sr-Cyrl-CS.resx
│ │ ├── Tesla.sr.resx
│ │ └── Tesla.sr-SP-Cyrl.resx
│ ├── SecurityTemplate.cs
│ ├── Spring.Core.Tests.2002.csproj
│ ├── Spring.Core.Tests.2003.csproj
│ ├── Spring.Core.Tests.2005.csproj
│ ├── Spring.Core.Tests.2008.csproj
│ ├── Spring.Core.Tests.2010.csproj
│ ├── Spring.Core.Tests.build
│ ├── Spring.Core.Tests.dll-1.1.config
│ ├── Spring.Core.Tests.dll.config
│ ├── StandardsComplianceTest.cs
│ ├── StopWatch.cs
│ ├── StreamHelperDecorator.cs
│ ├── TestResourceLoader.cs
│ ├── TestResource.txt
│ ├── Threading
│ │ ├── AsyncTestMethod.cs
│ │ ├── AsyncTestTask.cs
│ │ ├── CallContextStorageTests.cs
│ │ ├── CommonThreadStorageTests.cs
│ │ ├── LatchTest.cs
│ │ ├── LogicalThreadContextTest.cs
│ │ ├── SemaphoreTest.cs
│ │ ├── SyncHolderTest.cs
│ │ └── ThreadStaticStorageTests.cs
│ ├── Util
│ │ ├── ArrayUtilsTests.cs
│ │ ├── AssertUtilsTests.cs
│ │ ├── CollectionUtilsTests.cs
│ │ ├── ConfigXmlDocumentTests.cs
│ │ ├── ConfigXmlDocumentTests_SampleConfig.xml
│ │ ├── DefensiveEventRaiserTests.cs
│ │ ├── DelegateInfoTests.cs
│ │ ├── EventRaiserTests.cs
│ │ ├── NumberUtilsTests.cs
│ │ ├── ObjectUtilsTests.cs
│ │ ├── PathMatcherTest.cs
│ │ ├── PatternMatchUtilsTests.cs
│ │ ├── PropertiesTests.cs
│ │ ├── ReflectionUtilsMemberwiseCopyTests.cs
│ │ ├── ReflectionUtilsTests.cs
│ │ ├── SerializationTestUtils.cs
│ │ ├── StringUtilsTests.cs
│ │ ├── SystemUtilsTests.cs
│ │ └── UniqueKeyTests.cs
│ └── Validation
│ ├── Actions
│ │ ├── ErrorMessageActionTests.cs
│ │ ├── ExceptionActionTests.cs
│ │ └── ExpressionActionTests.cs
│ ├── AnyValidatorGroupTests.cs
│ ├── CollectionValidatorTests.cs
│ ├── ExclusiveValidatorGroupTests.cs
│ ├── HelperClasses.cs
│ ├── ValidationErrorsTests.cs
│ ├── ValidationExceptionTests.cs
│ ├── ValidationNamespaceParserTests.cs
│ ├── ValidationNamespaceParserTests_WhenConfigFileIsNotValid.xml
│ ├── ValidationNamespaceParserTests_WhenConfigFileIsValid.xml
│ ├── ValidatorGroupTests.cs
│ ├── ValidatorReferenceTests.cs
│ └── Validators
│ ├── ConditionValidatorTests.cs
│ ├── CreditCardValidatorTests.cs
│ ├── EmailValidatorTests.cs
│ ├── Integration
│ │ ├── CreditCardValidatorIntegrationTests.cs
│ │ ├── EmailValidatorIntegrationTests.cs
│ │ ├── ISBNValidatorIntegrationTests.cs
│ │ └── UrlValidatorIntegrationTests.cs
│ ├── ISBNValidatorTests.cs
│ ├── RegularExpressionValidatorTests.cs
│ ├── RequiredValidatorTests.cs
│ └── UrlValidatorTests.cs
├── Spring.Data.Integration.Tests
│ ├── Data
│ │ ├── AccountCreditDao.cs
│ │ ├── AccountDebitDao.cs
│ │ ├── AccountManager.cs
│ │ ├── AdoDaoTests.cs
│ │ ├── AdoTemplatePerformanceTests.cs
│ │ ├── AdoTemplateTests.cs
│ │ ├── adoTemplateTests.xml
│ │ ├── autoDeclarativeServices.xml
│ │ ├── AutoDeclarativeTxTests.cs
│ │ ├── CallCreateTestObject.cs
│ │ ├── ConsoleLoggingAroundAdvice.cs
│ │ ├── CreateTestObjectNonQuery.cs
│ │ ├── CreateTestObject.sql
│ │ ├── CreditsDebitsSchema.sql
│ │ ├── declarativeServices.xml
│ │ ├── DeclarativeTxTests.cs
│ │ ├── DTC1.1AppContext.xml
│ │ ├── DTCAppContextNoInterfaces.xml
│ │ ├── DTCAppContext.xml
│ │ ├── DTCTests.cs
│ │ ├── DTCTestsNoInterfaces.cs
│ │ ├── Generic
│ │ │ ├── GenericAdoTemplateTests.cs
│ │ │ ├── GenericAdoTemplateTests.xml
│ │ │ ├── ITestObjectDao.cs
│ │ │ ├── TestObjectDao.cs
│ │ │ └── TestObjectRowMapper.cs
│ │ ├── IAccountCreditDao.cs
│ │ ├── IAccountDebitDao.cs
│ │ ├── IAccountManager.cs
│ │ ├── ITestCoordinator.cs
│ │ ├── ITestObjectDao.cs
│ │ ├── ITestObjectManager.cs
│ │ ├── MappingAdoQueryTests.cs
│ │ ├── NativeAdoTestObjectDao.cs
│ │ ├── NativeAdoTests.cs
│ │ ├── nativeAdoTests.xml
│ │ ├── NestedTxScopeTests.cs
│ │ ├── Northwind
│ │ │ ├── AdoTemplateShipperDao.cs
│ │ │ ├── IShipperDao.cs
│ │ │ ├── NativeAdoShipperDao.cs
│ │ │ └── Shipper.cs
│ │ ├── Objects
│ │ │ └── Generic
│ │ │ ├── MappingVacationQuery.cs
│ │ │ ├── StoredProcedureTests.cs
│ │ │ ├── Vacation.cs
│ │ │ └── VacationRowMapper.cs
│ │ ├── OracleAdoTemplateTests.cs
│ │ ├── oracleAdoTemplateTests.xml
│ │ ├── SimpleAccountCreditDao.cs
│ │ ├── SimpleAccountDebitDao.cs
│ │ ├── SimpleAccountManager.cs
│ │ ├── SQLiteTests.cs
│ │ ├── StoredProcedureTests.cs
│ │ ├── Support
│ │ │ └── SimpleExceptionTranslationTests.cs
│ │ ├── templateTests.xml
│ │ ├── TestCoordinator.cs
│ │ ├── TestObjectDao.cs
│ │ ├── TestObjectManager.cs
│ │ ├── TestObjectQuery.cs
│ │ ├── testobjects-sqlserver.sql
│ │ ├── TestObjectStoredProcedure.cs
│ │ ├── TestTxIsolationLevelTests.cs
│ │ ├── TestTxIsolationLevel.xml
│ │ └── TransactionTemplateTests.cs
│ ├── Spring.Data.Integration.Tests.2003.csproj
│ ├── Spring.Data.Integration.Tests.2005.csproj
│ ├── Spring.Data.Integration.Tests.2008.csproj
│ ├── Spring.Data.Integration.Tests.2010.csproj
│ ├── Spring.Data.Integration.Tests.build
│ └── Spring.Data.Integration.Tests.dll.config
├── Spring.Data.NHibernate20.Integration.Tests
│ ├── Data
│ │ └── NHibernate
│ │ ├── Credit.hbm.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── templateTests.xml
│ │ └── TestObject.hbm.xml
│ ├── RecreateDatabases.sql
│ ├── Setup.cs
│ ├── Spring.Data.NHibernate20.Integration.Tests.2005.csproj
│ ├── Spring.Data.NHibernate20.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate20.Integration.Tests.build
│ └── Spring.Data.NHibernate20.Integration.Tests.dll.config
├── Spring.Data.NHibernate20.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── HibernateCompilerOptionsTests.cs
│ ├── HibernateExceptionTests.cs
│ ├── Spring.Data.NHibernate20.Tests.2005.csproj
│ ├── Spring.Data.NHibernate20.Tests.2008.csproj
│ ├── Spring.Data.NHibernate20.Tests.2010.csproj
│ ├── Spring.Data.NHibernate20.Tests.build
│ └── Spring.Data.NHibernate20.Tests.dll.config
├── Spring.Data.NHibernate21.Integration.Tests
│ ├── Config
│ │ └── Log4Net.xml
│ ├── Data
│ │ └── NHibernate
│ │ ├── AccountController.cs
│ │ ├── Bytecode
│ │ │ ├── AbstractInjectableUserTypeFixture.cs
│ │ │ ├── Foo.cs
│ │ │ ├── Foo.Spechbm.xml
│ │ │ ├── IDelimiter.cs
│ │ │ ├── InjectableStringUserType.cs
│ │ │ ├── InjectableUserTypeFixture.cs
│ │ │ ├── NHibernateTestImports.cs
│ │ │ └── Product.cs
│ │ ├── Controllers.xml
│ │ ├── Credit.hbm.xml
│ │ ├── Dao.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── HibernateTxScopeTransactionManagerTests.cs
│ │ ├── HibernateTxScopeTransactionManagerTests.xml
│ │ ├── IAccountController.cs
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── Services.xml
│ │ ├── SimpleTestDao.cs
│ │ ├── templateTests.xml
│ │ ├── TestObject.hbm.xml
│ │ └── txScopeBugTests.xml
│ ├── NHibernate.Test.dll.config
│ ├── README.TXT
│ ├── RecreateDatabases.sql
│ ├── Setup.cs
│ ├── Spring.Data.NHibernate21.Integration.Tests.2005.csproj
│ ├── Spring.Data.NHibernate21.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate21.Integration.Tests.2010.csproj
│ ├── Spring.Data.NHibernate21.Integration.Tests.build
│ ├── Spring.Data.NHibernate21.Integration.Tests.dll.config
│ └── TestEnbeddedConfig.cfg.xml
├── Spring.Data.NHibernate21.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── DelegatingLocalSessionFactoryObjectTests.cs
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── HibernateCompilerOptionsTests.cs
│ ├── HibernateExceptionTests.cs
│ ├── Spring.Data.NHibernate21.Tests.2005.csproj
│ ├── Spring.Data.NHibernate21.Tests.2008.csproj
│ ├── Spring.Data.NHibernate21.Tests.2010.csproj
│ ├── Spring.Data.NHibernate21.Tests.build
│ └── Spring.Data.NHibernate21.Tests.dll.config
├── Spring.Data.NHibernate30.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Credit.hbm.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── templateTests.xml
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate30.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate30.Integration.Tests.2010.csproj
│ ├── Spring.Data.NHibernate30.Integration.Tests.build
│ └── Spring.Data.NHibernate30.Integration.Tests.dll.config
├── Spring.Data.NHibernate30.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate30.Tests.2008.csproj
│ ├── Spring.Data.NHibernate30.Tests.2010.csproj
│ ├── Spring.Data.NHibernate30.Tests.build
│ └── Spring.Data.NHibernate30.Tests.dll.config
├── Spring.Data.NHibernate31.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Credit.hbm.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── templateTests.xml
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate31.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate31.Integration.Tests.build
│ └── Spring.Data.NHibernate31.Integration.Tests.dll.config
├── Spring.Data.NHibernate31.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate31.Tests.2008.csproj
│ ├── Spring.Data.NHibernate31.Tests.2010.csproj
│ ├── Spring.Data.NHibernate31.Tests.build
│ └── Spring.Data.NHibernate31.Tests.dll.config
├── Spring.Data.NHibernate32.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Credit.hbm.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── templateTests.xml
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate32.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate32.Integration.Tests.build
│ └── Spring.Data.NHibernate32.Integration.Tests.dll.config
├── Spring.Data.NHibernate32.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate32.Tests.2008.csproj
│ ├── Spring.Data.NHibernate32.Tests.2010.csproj
│ ├── Spring.Data.NHibernate32.Tests.build
│ └── Spring.Data.NHibernate32.Tests.dll.config
├── Spring.Data.NHibernate.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── AccountCreditDao.cs
│ │ ├── AccountDebitDao.cs
│ │ ├── AccountManager.cs
│ │ ├── AuditDao.cs
│ │ ├── Credit.cs
│ │ ├── creditdebit.sql
│ │ ├── Credit.hbm.xml
│ │ ├── DbProviderTemplateTests.cs
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.cs
│ │ ├── Debit.hbm.xml
│ │ ├── IAccountCreditDao.cs
│ │ ├── IAccountDebitDao.cs
│ │ ├── IAccountManager.cs
│ │ ├── IAuditDao.cs
│ │ ├── ITestObjectDao.cs
│ │ ├── MultipleDbTests.cs
│ │ ├── MultipleDbTests.xml
│ │ ├── NativeNHTestObjectDao.cs
│ │ ├── NativeNHTests.cs
│ │ ├── NHDAOTests.cs
│ │ ├── NHDAOTests.xml
│ │ ├── NHTestObjectDao.cs
│ │ ├── TemplateTests.cs
│ │ ├── templateTests.xml
│ │ ├── TestObject.cs
│ │ ├── TestObject.hbm.xml
│ │ └── testObject.sql
│ ├── Spring.Data.NHibernate.Integration.Tests.2003.csproj
│ ├── Spring.Data.NHibernate.Integration.Tests.2005.csproj
│ ├── Spring.Data.NHibernate.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate.Integration.Tests.2010.csproj
│ ├── Spring.Data.NHibernate.Integration.Tests.build
│ └── Spring.Data.NHibernate.Integration.Tests.dll.config
├── Spring.Data.NHibernate.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfiguration.cs
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── HibernateTransactionManagerTests.cs
│ │ ├── ISimpleService.cs
│ │ ├── ITestObjectDao.cs
│ │ ├── LocalSessionFactoryObjectTests.cs
│ │ ├── NHTestObjectDao.cs
│ │ ├── SessionFactoryUtilsTests.cs
│ │ ├── SimpleService.cs
│ │ ├── Support
│ │ │ ├── ConfigSectionSessionScopeSettingsTests.cs
│ │ │ ├── SessionScopeSettingsTests.cs
│ │ │ └── SessionScopeTests.cs
│ │ ├── TestObject.cs
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate.Tests.2003.csproj
│ ├── Spring.Data.NHibernate.Tests.2005.csproj
│ ├── Spring.Data.NHibernate.Tests.2008.csproj
│ ├── Spring.Data.NHibernate.Tests.build
│ └── Spring.Data.NHibernate.Tests.dll.config
├── Spring.Data.Tests
│ ├── AssemblyInfo.cs
│ ├── Dao
│ │ ├── Attributes
│ │ │ ├── PersistenceExceptionTranslationAdvisorTests.cs
│ │ │ ├── PersistenceExceptionTranslationInterceptorTests.cs
│ │ │ └── PersistenceExceptionTranslationPostProcessorTests.cs
│ │ ├── IncorrectResultSizeDataAccessExceptionTests.cs
│ │ ├── IncorrectUpdateSemanticsDataAccessExceptionTests.cs
│ │ ├── Support
│ │ │ └── DataAccessUtilsTests.cs
│ │ └── UncategorizedDataAccessExceptionTests.cs
│ ├── Data
│ │ ├── AdoPlatformTransactionManagerTests.cs
│ │ ├── AutoDeclarativeTxTests.cs
│ │ ├── AutoDeclarativeTxTests.xml
│ │ ├── Common
│ │ │ ├── AdditionalProviders.xml
│ │ │ ├── DbParametersTests.cs
│ │ │ ├── DbProviderFactoryTests.cs
│ │ │ ├── DbProviderFactoryTests.xml
│ │ │ ├── MultiDelegatingDbProviderTests.cs
│ │ │ └── UserCredentialsDbProviderTests.cs
│ │ ├── Core
│ │ │ ├── ServiceDomainTransactionManagerTests.cs
│ │ │ ├── TxScopeTransactionManagerIntegrationTests.cs
│ │ │ └── TxScopeTransactionManagerTests.cs
│ │ ├── ITestCoord.cs
│ │ ├── ITestObjectMgr.cs
│ │ ├── LoggingAroundAdvice.cs
│ │ ├── Objects
│ │ │ ├── AbstractAdoQueryTests.cs
│ │ │ ├── AdoOperationTests.cs
│ │ │ ├── AdoQueryTests.cs
│ │ │ └── StoredProcedureTests.cs
│ │ ├── TestCoord.cs
│ │ └── TestObjectMgr.cs
│ ├── DataCompilerOptionsTests.cs
│ ├── DataExceptionTests.cs
│ ├── Spring.Data.Tests.2003.csproj
│ ├── Spring.Data.Tests.2005.csproj
│ ├── Spring.Data.Tests.2008.csproj
│ ├── Spring.Data.Tests.2010.csproj
│ ├── Spring.Data.Tests.build
│ ├── Spring.Data.Tests.dll.config
│ ├── Support
│ │ ├── ErrorCodeExceptionTranslatorTests.cs
│ │ ├── TestDbProvider.cs
│ │ └── TestSqlException.cs
│ └── Transaction
│ ├── CallCountingTransactionManager.cs
│ ├── CommonTypes.cs
│ ├── Config
│ │ ├── TxNamespaceParserTests.cs
│ │ ├── TxNamespaceParserTests_TxAttributeDriven.xml
│ │ └── TxNamespaceParserTests.xml
│ ├── HeuristicCompletionExceptionTests.cs
│ ├── Interceptor
│ │ ├── AbstractTransactionAspectTests.cs
│ │ ├── DefaultTransactionAttributeTests.cs
│ │ ├── MatchAlwaysTransactionAttributeSourceTests.cs
│ │ ├── MatchAlwaysTransactionAttributeSourceTests.xml
│ │ ├── NoRollbackRuleAttributeTests.cs
│ │ ├── RollbackRuleAttributeTests.cs
│ │ ├── RuleBasedTransactionAttributeTests.cs
│ │ ├── TransactionAttributeEditorTests.cs
│ │ ├── TransactionAttributeSourceAdvisorTests.cs
│ │ ├── TransactionAttributeSourceEditorTests.cs
│ │ ├── TransactionAttributeSourceTests.cs
│ │ └── TransactionInterceptorTests.cs
│ ├── InvalidTimeoutExceptionTests.cs
│ └── Support
│ ├── AbstractPlatformTransactionManagerTests.cs
│ ├── DefaultTransactionDefinitionTests.cs
│ ├── DefaultTransactionStatusTests.cs
│ ├── ResourceHolderSupportTests.cs
│ ├── TransactionSynchronizationAdapterTests.cs
│ ├── TransactionSynchronizationManagerTests.cs
│ └── TransactionTemplateTests.cs
├── Spring.Messaging.Ems.Tests
│ ├── AssemblyInfo.cs
│ ├── Messaging
│ │ └── Ems
│ │ ├── Connections
│ │ │ ├── CachingConnectionFactoryTests.cs
│ │ │ ├── MessageTransactionManagerTests.cs
│ │ │ ├── SingleConnectionFactoryTests.cs
│ │ │ ├── TestConnection.cs
│ │ │ ├── TestExceptionListener.cs
│ │ │ ├── TestMessageConsumer.cs
│ │ │ ├── TestMessageListener.cs
│ │ │ ├── TestMessageProducer.cs
│ │ │ ├── TestSession.cs
│ │ │ └── TestTopicSubscriber.cs
│ │ ├── Core
│ │ │ ├── MessageTemplateTests.cs
│ │ │ ├── SimpleMessageConverterTests.cs
│ │ │ └── SimpleMessageListenerContainerTests.cs
│ │ ├── Integration
│ │ │ ├── LoggingExceptionHandler.cs
│ │ │ ├── SimpleMessageListenerContainerTests.cs
│ │ │ ├── SimpleMessageListenerContainerTests.xml
│ │ │ └── SimpleMessageListener.cs
│ │ └── Jndi
│ │ ├── ExpectedLookupContext.cs
│ │ └── JndiLookupFactoryObjectTests.cs
│ ├── Spring.Messaging.Ems.Tests.2005.csproj
│ ├── Spring.Messaging.Ems.Tests.2008.csproj
│ ├── Spring.Messaging.Ems.Tests.2010.csproj
│ ├── Spring.Messaging.Ems.Tests.build
│ └── Spring.Messaging.Ems.Tests.dll.config
├── Spring.Messaging.Nms.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Messaging
│ │ └── Nms
│ │ ├── Core
│ │ │ ├── NmsTemplateTests.cs
│ │ │ ├── NmsTemplateTests.xml
│ │ │ ├── SimpleGateway.cs
│ │ │ └── SimpleMessageListener.cs
│ │ └── Listener
│ │ ├── SimpleMessageListenerContainerTests.cs
│ │ └── SimpleMessageListenerContainerTests.xml
│ ├── Properties
│ ├── Spring.Messaging.Nms.Integration.Tests.build
│ ├── Spring.Messaging.Nms.Integration.Tests.csproj
│ └── Spring.Messaging.Nms.Integration.Tests.dll.config
├── Spring.Messaging.Nms.Tests
│ ├── AssemblyInfo.cs
│ ├── Messaging
│ │ └── Nms
│ │ ├── Config
│ │ │ ├── NmsNamespaceHandlerTests.cs
│ │ │ └── NmsNamespaceHandlerTests.xml
│ │ ├── Connections
│ │ │ ├── CachingConnectionFactoryTests.cs
│ │ │ ├── MessageTransactionManagerTests.cs
│ │ │ ├── SingleConnectionFactoryTests.cs
│ │ │ ├── TestConnection.cs
│ │ │ ├── TestConnectionFactory.cs
│ │ │ ├── TestExceptionListener.cs
│ │ │ ├── TestMessageConsumer.cs
│ │ │ ├── TestMessageListener.cs
│ │ │ ├── TestMessageProducer.cs
│ │ │ └── TestSession.cs
│ │ ├── Core
│ │ │ ├── MessageTemplateTests.cs
│ │ │ ├── SimpleMessageConverterTests.cs
│ │ │ └── SimpleMessageListenerContainerTests.cs
│ │ ├── Integration
│ │ │ ├── LoggingExceptionHandler.cs
│ │ │ ├── SimpleMessageListenerContainerTests.cs
│ │ │ ├── SimpleMessageListenerContainerTests.xml
│ │ │ └── SimpleMessageListener.cs
│ │ ├── Listener
│ │ │ └── Adapter
│ │ │ ├── IMessageContentsHandler.cs
│ │ │ ├── MessageContentsHandler.cs
│ │ │ └── MessageListenerAdapterTests.cs
│ │ ├── StubQueue.cs
│ │ └── Support
│ │ └── Converter
│ │ └── TypeMapperTests.cs
│ ├── NmsCompilerOptionsTests.cs
│ ├── NmsExceptionTests.cs
│ ├── Properties
│ ├── Spring.Messaging.Nms.Tests.2003.csproj
│ ├── Spring.Messaging.Nms.Tests.2005.csproj
│ ├── Spring.Messaging.Nms.Tests.2008.csproj
│ ├── Spring.Messaging.Nms.Tests.2010.csproj
│ ├── Spring.Messaging.Nms.Tests.build
│ └── Spring.Messaging.Nms.Tests.dll.config
├── Spring.Messaging.Tests
│ ├── Messaging
│ │ ├── Core
│ │ │ ├── MessageQueueMetadataCacheTests.cs
│ │ │ ├── MessageQueueMetadataCacheTests.xml
│ │ │ ├── MessageQueueTemplateTests.cs
│ │ │ ├── MessageQueueTemplateTests.xml
│ │ │ ├── MessageQueueUtils.cs
│ │ │ └── ThreadingTests.cs
│ │ ├── Listener
│ │ │ ├── Adapter
│ │ │ │ ├── MessageListenerAdapterTests.cs
│ │ │ │ └── StandardReflectionMessageListenerAdapter.cs
│ │ │ ├── DistributedTxMessageListenerContainerTests.cs
│ │ │ ├── DistributedTxMessageListenerContainerTests.xml
│ │ │ ├── LoggingExceptionHandler.cs
│ │ │ ├── MultiThreadedNonTransactionalMessageListenerContainerTests.cs
│ │ │ ├── MultiThreadedNonTransactionalMessageListenerContainerTests.xml
│ │ │ ├── NonTransactionalMessageListenerContainerTests.cs
│ │ │ ├── NonTransactionalMessageListenerContainerTests.xml
│ │ │ ├── SimpleExceptionHandler.cs
│ │ │ ├── SimpleHandler.cs
│ │ │ ├── SimpleMessageListener.cs
│ │ │ ├── TransactionalMessageListenerContainerTests.cs
│ │ │ ├── TransactionalMessageListenerContainerTests.xml
│ │ │ └── WaitingHandler.cs
│ │ ├── queue-context.xml
│ │ └── Support
│ │ ├── MessageAlreadyProcessedException.cs
│ │ └── MessageQueueFactoryObjectTests.cs
│ ├── MessagingCompilerOptionsTests.cs
│ ├── MessagingExceptionTests.cs
│ ├── Properties
│ │ └── AssemblyInfo.cs
│ ├── Spring.Messaging.Tests.2005.csproj
│ ├── Spring.Messaging.Tests.2008.csproj
│ ├── Spring.Messaging.Tests.2010.csproj
│ ├── Spring.Messaging.Tests.build
│ └── Spring.Messaging.Tests.dll.config
├── Spring.Scheduling.Quartz.Tests
│ ├── job-scheduling-data.xml
│ ├── multipleAnonymousMethodInvokingJobDetailFB.xml
│ ├── multipleSchedulers.xml
│ ├── QuartzCompilerOptionsTests.cs
│ ├── schedulerAccessorObject.xml
│ ├── schedulerRepositoryExposure.xml
│ ├── Scheduling
│ │ └── Quartz
│ │ ├── AdaptableJobFactoryTest.cs
│ │ ├── CronTriggerObjectTest.cs
│ │ ├── JobDetailObjectTest.cs
│ │ ├── MethodInvokingJobDetailFactoryObjectTest.cs
│ │ ├── MethodInvokingJobTest.cs
│ │ ├── QuartzSupportTests.cs
│ │ ├── QuartzTestObject.cs
│ │ ├── SchedulerFactoryObjectTest.cs
│ │ ├── SimpleTriggerObjectTest.cs
│ │ ├── SpringObjectJobFactoryTest.cs
│ │ ├── TestMethodInvokingTask.cs
│ │ ├── TestUtil.cs
│ │ └── TriggerObjectTest.cs
│ ├── Spring.Scheduling.Quartz.Tests.2003.csproj
│ ├── Spring.Scheduling.Quartz.Tests.2005.csproj
│ ├── Spring.Scheduling.Quartz.Tests.2008.csproj
│ ├── Spring.Scheduling.Quartz.Tests.2010.csproj
│ ├── Spring.Scheduling.Quartz.Tests.build
│ └── Spring.Scheduling.Quartz.Tests.dll.config
├── Spring.Services.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ ├── Spring
│ │ │ ├── Remoting
│ │ │ │ ├── autowire.xml
│ │ │ │ ├── caoLifetimeService.xml
│ │ │ │ ├── cao.xml
│ │ │ │ ├── remotingConfigurer.xml
│ │ │ │ ├── saoLifetimeService.xml
│ │ │ │ ├── saoSingleCall.xml
│ │ │ │ ├── saoSingleton-aop.xml
│ │ │ │ ├── saoSingleton-autowired.xml
│ │ │ │ └── saoSingleton.xml
│ │ │ ├── Web
│ │ │ │ └── Services
│ │ │ │ ├── configurableFactory.xml
│ │ │ │ ├── document-literal.wsdl
│ │ │ │ ├── nestedSchema.wsdl
│ │ │ │ ├── nestedSchema.xsd
│ │ │ │ ├── rpc-literal.wsdl
│ │ │ │ └── Service.cs.fyi
│ │ │ └── WindowsService
│ │ │ ├── Cassini
│ │ │ │ ├── localizer.xml
│ │ │ │ ├── service.config
│ │ │ │ ├── service.xml
│ │ │ │ ├── watcher.xml
│ │ │ │ └── wwwroot
│ │ │ ├── Echo
│ │ │ │ ├── service.config
│ │ │ │ ├── service.xml
│ │ │ │ └── watcher.xml
│ │ │ └── Simple
│ │ │ ├── service.config
│ │ │ ├── service.xml
│ │ │ └── watcher.xml
│ │ └── Xml
│ │ ├── watcher-0.xml
│ │ ├── watcher-1.xml
│ │ └── watcher-simple.xml
│ ├── EnterpriseServices
│ │ ├── ExeConfigurationSystemTests.config
│ │ ├── ExeConfigurationSystemTests.cs
│ │ ├── ExportedServicedComponentSample.cs
│ │ └── ServicedComponentExporterTests.cs
│ ├── Remoting
│ │ ├── BaseRemotingTestFixture.cs
│ │ ├── CaoExporterTests.cs
│ │ ├── CaoFactoryObjectTests.cs
│ │ ├── ISimpleCounter.cs
│ │ ├── RemoteObjectFactoryTests.cs
│ │ ├── RemotingConfigParserTests.cs
│ │ ├── RemotingConfigurerTests.cs
│ │ ├── SaoExporterTests.cs
│ │ ├── SaoFactoryObjectTests.cs
│ │ └── SimpleCounter.cs
│ ├── ServiceComponentExporterTests.TestServicedComponents.dll.config
│ ├── ServiceComponentExporterTests.TestServicedComponents.exe.config
│ ├── ServiceComponentExporterTests.TestServicedComponents.Services.xml
│ ├── ServiceModel
│ │ ├── Config
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.BasicConfig.xml
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.cs
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.CustomProperties.xml
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.WithoutId.xml
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.WithTypeAlias.xml
│ │ │ └── WcfNamespaceParserTests.cs
│ │ ├── ServiceExporterTests.cs
│ │ └── SpringServiceHostTests.cs
│ ├── ServicesCompilerOptionsTests.cs
│ ├── Spring.Services.Tests.2003.csproj
│ ├── Spring.Services.Tests.2005.csproj
│ ├── Spring.Services.Tests.2008.csproj
│ ├── Spring.Services.Tests.2010.csproj
│ ├── Spring.Services.Tests.build
│ ├── Spring.Services.Tests.dll-1.1.config
│ ├── Spring.Services.Tests.dll.config
│ ├── Spring.Services.WindowsService.Samples.csproj
│ ├── Spring.Services.WindowsService.Tests.build
│ ├── Spring.Services.WindowsService.Tests.csproj
│ ├── tests.config
│ ├── Web
│ │ └── Services
│ │ └── WebServiceProxyFactoryTests.cs
│ └── WindowsService
│ ├── Common
│ │ ├── ApplicationHostTest.cs
│ │ ├── ApplicationTest.cs
│ │ ├── Deploy
│ │ │ ├── AggregatedDeployEventDispatcherTest.cs
│ │ │ ├── ApplicationWatcherManagerTest.cs
│ │ │ ├── DeployEventAggregatorTest.cs
│ │ │ ├── DeployManagerTest.cs
│ │ │ ├── FileSystem
│ │ │ │ ├── DefaultApplicationWatcherFactoryTest.cs
│ │ │ │ ├── FileSystemApplicationWatcherTest.cs
│ │ │ │ ├── FileSystemDeployLocationTest.cs
│ │ │ │ ├── FileSystemMonitorTest.cs
│ │ │ │ └── RegularExpressionFilterConfigurerTest.cs
│ │ │ ├── NullSync.cs
│ │ │ ├── SpringAssembliesDeployerTest.cs
│ │ │ └── TestingHandler.cs
│ │ ├── Gui
│ │ │ └── ApplicationMonitorTest.cs
│ │ ├── LocalizerTest.cs
│ │ ├── ServiceSupportTest.cs
│ │ └── UtilsTest.cs
│ ├── IntegrationTest.cs
│ ├── Samples
│ │ ├── ASMXExecutor.cs
│ │ ├── Echo
│ │ │ └── Echo.cs
│ │ ├── echo.asmx
│ │ ├── service.config
│ │ ├── service.xml
│ │ ├── Simple
│ │ │ └── Simple.cs
│ │ ├── Simple.cs
│ │ └── watcher.xml
│ └── TestUtils.cs
├── Spring.Template.Velocity.Tests
│ ├── Properties
│ ├── Spring.Template.Velocity.Tests.2010.csproj
│ ├── Spring.Template.Velocity.Tests.build
│ ├── Spring.Template.Velocity.Tests.csproj
│ ├── Template
│ │ └── Velocity
│ │ ├── Config
│ │ │ └── TemplateNamespaceParserTests.cs
│ │ ├── config.properties
│ │ ├── EmbeddedTemplate.vm
│ │ ├── SimpleTemplate.vm
│ │ ├── VelocityEngineFactoryObjectTests.cs
│ │ ├── VelocityEngineFactoryObjectTests.xml
│ │ └── VelocityEngineTestBase.cs
│ └── VelocityCompilerOptionsTests.cs
├── Spring.Testing.Microsoft.Tests
│ ├── app.config
│ ├── AssemblyInfo.cs
│ ├── Properties
│ ├── Spring.Testing.Microsoft.Tests.2008.csproj
│ ├── Spring.Testing.Microsoft.Tests.2010.csproj
│ ├── Spring.Testing.Microsoft.Tests.build
│ ├── Spring.Testing.Microsoft.Tests.dll.config
│ └── Testing
│ └── Microsoft
│ ├── AbstractDependencyInjectionSpringContextTestsTests.cs
│ └── TestApplicationContext.xml
├── Spring.Testing.NUnit.Tests
│ ├── AssemblyInfo.cs
│ ├── NUnitCompilerOptionsTests.cs
│ ├── Spring.Testing.NUnit.Tests.2003.csproj
│ ├── Spring.Testing.NUnit.Tests.2005.csproj
│ ├── Spring.Testing.NUnit.Tests.2008.csproj
│ ├── Spring.Testing.NUnit.Tests.2010.csproj
│ ├── Spring.Testing.NUnit.Tests.build
│ ├── Spring.Testing.NUnit.Tests.dll.config
│ └── Testing
│ ├── Ado
│ │ └── SimpleAdoTestUtilsTests.cs
│ └── NUnit
│ ├── AbstractDependencyInjectionSpringContextTestsTests.cs
│ └── TestApplicationContext.xml
├── Spring.Web.Mvc3.Tests
│ ├── ControllerFactoryTestExtension.cs
│ ├── Controllers
│ │ ├── FirstContainerRegisteredController.cs
│ │ ├── NamedContextController.cs
│ │ ├── NotInContainerController.cs
│ │ └── SecondContainerRegisteredController.cs
│ ├── namedContextObjectsMvc3.xml
│ ├── objectsMvc3.xml
│ ├── Properties
│ ├── SpringMvcDependencyResolverTests.cs
│ ├── Spring.Web.Mvc3.Tests.2010.csproj
│ └── Spring.Web.Mvc3.Tests.build
├── Spring.Web.Mvc.Tests
│ ├── ControllerFactoryTestExtension.cs
│ ├── Controllers
│ │ ├── FirstContainerRegisteredController.cs
│ │ ├── NamedContextController.cs
│ │ ├── NotInContainerController.cs
│ │ └── SecondContainerRegisteredController.cs
│ ├── namedContextObjects.xml
│ ├── objectsMatchByType.xml
│ ├── objects.xml
│ ├── Properties
│ ├── SpringControllerFactoryTests.cs
│ ├── Spring.Web.Mvc.Tests.2010.csproj
│ └── Spring.Web.Mvc.Tests.build
└── Spring.Web.Tests
├── AssemblyInfo.cs
├── Caching
│ └── AspNetCacheTests.cs
├── Context
│ └── Support
│ ├── HttpApplicationConfigurerMergablePropertiesTests.xml
│ ├── HttpApplicationConfigurerTests.cs
│ ├── HttpApplicationConfigurerTests.xml
│ ├── WebApplicationContextArgsTests.cs
│ ├── WebApplicationContextTests.cs
│ ├── WebContextHandlerTests.cs
│ └── WebContextHandlerTests.xml
├── Core
│ └── IO
│ └── WebResourceTests.cs
├── Data
│ └── Spring
│ ├── Context
│ │ └── Support
│ │ └── WebApplicationContextTests
│ │ ├── Dummy.aspx
│ │ └── Web.Config
│ ├── Objects
│ │ └── Factory
│ │ └── Support
│ │ ├── TestForm.aspx
│ │ └── TestForm.aspx.cs
│ └── Web
│ └── Support
│ ├── LocalResourceManagerTests
│ │ ├── App_LocalResources
│ │ │ └── WithResources.aspx.resx
│ │ ├── Web.Config
│ │ ├── WithoutResources.aspx
│ │ └── WithResources.aspx
│ └── PageHandlerFactoryTests
│ ├── DisablesSession.aspx
│ ├── MaintainsSession1.aspx
│ ├── MaintainsSession2.aspx
│ ├── ReadOnlySession.aspx
│ ├── TransferAfterSetResult.aspx
│ ├── TransferAfterSetResultSave.aspx
│ ├── Web.Config.net-1.1
│ └── Web.Config.net-2.0
├── Globalization
│ └── Resolvers
│ └── DefaultWebCultureResolverTests.cs
├── Objects
│ └── Factory
│ ├── Support
│ │ ├── WebObjectDefinitionFactoryTests.cs
│ │ ├── WebObjectDefinitionTests.cs
│ │ ├── WebObjectFactoryTests.cs
│ │ └── WebObjectUtilsTests.cs
│ └── Xml
│ └── WebObjectDefinitionReaderTests.cs
├── Spring.Web.Tests.2003.csproj
├── Spring.Web.Tests.2005.csproj
├── Spring.Web.Tests.2008.csproj
├── Spring.Web.Tests.2010.csproj
├── Spring.Web.Tests.build
├── TestSupport
│ ├── DictionaryModelPersistenceMedium.cs
│ ├── NUnitAdapter.cs
│ ├── SessionMock.cs
│ ├── TestPage.cs
│ ├── TestUserControl.cs
│ ├── TestWebContext.cs
│ ├── TestWebContextTests.cs
│ ├── VirtualEnvironmentMock.cs
│ ├── VoidDelegate.cs
│ └── WebApplicationTests.cs
├── Threading
│ ├── HttpContextStorageTests.cs
│ └── HybridContextStorageTests.cs
├── Util
│ ├── WebDIPerformanceTests.cs
│ └── WebUtilsTests.cs
├── Web
│ ├── Services
│ │ └── WebServiceExporterTests.cs
│ ├── Support
│ │ ├── AbstractHandlerFactoryTests.cs
│ │ ├── ControlInterceptionTests.cs
│ │ ├── ControlInterceptionTests.objects.xml
│ │ ├── HandlerMapTests.cs
│ │ ├── LocalResourceManagerTests.cs
│ │ ├── MimeMediaTypeTests.cs
│ │ ├── PageHandlerFactoryTests.cs
│ │ ├── ResultFactoryRegistryTests.cs
│ │ └── ResultTests.cs
│ └── UI
│ ├── Controls
│ │ ├── AbstractValidationControlTests.cs
│ │ ├── HeadTests.cs
│ │ ├── ValidationErrorsTests.cs
│ │ └── ValidationSummaryTests.cs
│ ├── PageTests.cs
│ ├── SessionModelPersistenceMediumTests.cs
│ └── UserControlTests.cs
└── WebCompilerOptionsTests.cs
951 directories, 5166 files
最新官方完整包,1.3.2稳定版 Spring.Core 库是框架的基础, 提供依赖注入功能。Spring NET中大多数类库依赖或扩展了Spring.Core的功能。IObjectFactory接口提供了一个简单而优雅的工厂模式,移除了对单例和一些服务定位stub的必要。允许你将真正的程序逻辑与配置解耦。作为对IObjectFactory 的扩展,IApplicationContext接口也在Spring.Core库中, Spring DOTNET 是一个关注于.NET企业应用开发的应用程序框架。它能够提供很多方面的功能,例如控制反转(Inversion of Control,英文缩写为IoC)、依赖注入(Dependency Injection,英文缩写DI)、面向方面编程(AOP)、数据访问抽象, 以及ASP DOTNET集成等。基于java的spring框架的核心概念和价值已被应用到.NET。Spring DOTNET 1.0 包含一个完全功能的依赖注入容器和AOP库。后续的发布将包含对ASP DOTNET、Remoting和数据访问的支持。
【实例截图】
【核心代码】
4744302543288978128.zip
└── Spring.NET
├── bin
│ └── net
│ ├── 1.1
│ │ ├── debug
│ │ │ ├── Common.Logging.dll
│ │ │ ├── Spring.Aop.dll
│ │ │ ├── Spring.Aop.pdb
│ │ │ ├── Spring.Aop.xml
│ │ │ ├── Spring.Core.dll
│ │ │ ├── Spring.Core.pdb
│ │ │ ├── Spring.Core.xml
│ │ │ ├── Spring.Data.dll
│ │ │ ├── Spring.Data.NHibernate12.dll
│ │ │ ├── Spring.Data.NHibernate12.pdb
│ │ │ ├── Spring.Data.NHibernate12.xml
│ │ │ ├── Spring.Data.pdb
│ │ │ ├── Spring.Data.xml
│ │ │ ├── Spring.Services.dll
│ │ │ ├── Spring.Services.pdb
│ │ │ ├── Spring.Services.xml
│ │ │ ├── Spring.Testing.NUnit.dll
│ │ │ ├── Spring.Testing.NUnit.pdb
│ │ │ ├── Spring.Testing.NUnit.xml
│ │ │ ├── Spring.Web.dll
│ │ │ ├── Spring.Web.pdb
│ │ │ └── Spring.Web.xml
│ │ └── release
│ │ ├── Common.Logging.dll
│ │ ├── Spring.Aop.dll
│ │ ├── Spring.Aop.pdb
│ │ ├── Spring.Aop.xml
│ │ ├── Spring.Core.dll
│ │ ├── Spring.Core.pdb
│ │ ├── Spring.Core.xml
│ │ ├── Spring.Data.dll
│ │ ├── Spring.Data.NHibernate12.dll
│ │ ├── Spring.Data.NHibernate12.pdb
│ │ ├── Spring.Data.NHibernate12.xml
│ │ ├── Spring.Data.pdb
│ │ ├── Spring.Data.xml
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ ├── Spring.Services.xml
│ │ ├── Spring.Testing.NUnit.dll
│ │ ├── Spring.Testing.NUnit.pdb
│ │ ├── Spring.Testing.NUnit.xml
│ │ ├── Spring.Web.dll
│ │ ├── Spring.Web.pdb
│ │ └── Spring.Web.xml
│ ├── 2.0
│ │ ├── debug
│ │ │ ├── Common.Logging.dll
│ │ │ ├── Spring.Aop.dll
│ │ │ ├── Spring.Aop.pdb
│ │ │ ├── Spring.Aop.xml
│ │ │ ├── Spring.Core.dll
│ │ │ ├── Spring.Core.pdb
│ │ │ ├── Spring.Core.xml
│ │ │ ├── Spring.Data.dll
│ │ │ ├── Spring.Data.NHibernate12.dll
│ │ │ ├── Spring.Data.NHibernate12.pdb
│ │ │ ├── Spring.Data.NHibernate12.xml
│ │ │ ├── Spring.Data.NHibernate20.dll
│ │ │ ├── Spring.Data.NHibernate20.pdb
│ │ │ ├── Spring.Data.NHibernate20.xml
│ │ │ ├── Spring.Data.NHibernate21.dll
│ │ │ ├── Spring.Data.NHibernate21.pdb
│ │ │ ├── Spring.Data.NHibernate21.xml
│ │ │ ├── Spring.Data.pdb
│ │ │ ├── Spring.Data.xml
│ │ │ ├── Spring.Messaging.dll
│ │ │ ├── Spring.Messaging.Ems.dll
│ │ │ ├── Spring.Messaging.Ems.pdb
│ │ │ ├── Spring.Messaging.Ems.xml
│ │ │ ├── Spring.Messaging.Nms.dll
│ │ │ ├── Spring.Messaging.Nms.pdb
│ │ │ ├── Spring.Messaging.Nms.xml
│ │ │ ├── Spring.Messaging.pdb
│ │ │ ├── Spring.Messaging.xml
│ │ │ ├── Spring.Scheduling.Quartz.dll
│ │ │ ├── Spring.Scheduling.Quartz.pdb
│ │ │ ├── Spring.Scheduling.Quartz.xml
│ │ │ ├── Spring.Services.dll
│ │ │ ├── Spring.Services.pdb
│ │ │ ├── Spring.Services.xml
│ │ │ ├── Spring.Template.Velocity.dll
│ │ │ ├── Spring.Template.Velocity.pdb
│ │ │ ├── Spring.Template.Velocity.xml
│ │ │ ├── Spring.Testing.Microsoft.dll
│ │ │ ├── Spring.Testing.Microsoft.pdb
│ │ │ ├── Spring.Testing.Microsoft.xml
│ │ │ ├── Spring.Testing.NUnit.dll
│ │ │ ├── Spring.Testing.NUnit.pdb
│ │ │ ├── Spring.Testing.NUnit.xml
│ │ │ ├── Spring.Web.dll
│ │ │ ├── Spring.Web.Extensions.dll
│ │ │ ├── Spring.Web.Extensions.pdb
│ │ │ ├── Spring.Web.Extensions.xml
│ │ │ ├── Spring.Web.pdb
│ │ │ └── Spring.Web.xml
│ │ └── release
│ │ ├── Common.Logging.dll
│ │ ├── Spring.Aop.dll
│ │ ├── Spring.Aop.pdb
│ │ ├── Spring.Aop.xml
│ │ ├── Spring.Core.dll
│ │ ├── Spring.Core.pdb
│ │ ├── Spring.Core.xml
│ │ ├── Spring.Data.dll
│ │ ├── Spring.Data.NHibernate12.dll
│ │ ├── Spring.Data.NHibernate12.pdb
│ │ ├── Spring.Data.NHibernate12.xml
│ │ ├── Spring.Data.NHibernate20.dll
│ │ ├── Spring.Data.NHibernate20.pdb
│ │ ├── Spring.Data.NHibernate20.xml
│ │ ├── Spring.Data.NHibernate21.dll
│ │ ├── Spring.Data.NHibernate21.pdb
│ │ ├── Spring.Data.NHibernate21.xml
│ │ ├── Spring.Data.pdb
│ │ ├── Spring.Data.xml
│ │ ├── Spring.Messaging.dll
│ │ ├── Spring.Messaging.Ems.dll
│ │ ├── Spring.Messaging.Ems.pdb
│ │ ├── Spring.Messaging.Ems.xml
│ │ ├── Spring.Messaging.Nms.dll
│ │ ├── Spring.Messaging.Nms.pdb
│ │ ├── Spring.Messaging.Nms.xml
│ │ ├── Spring.Messaging.pdb
│ │ ├── Spring.Messaging.xml
│ │ ├── Spring.Scheduling.Quartz.dll
│ │ ├── Spring.Scheduling.Quartz.pdb
│ │ ├── Spring.Scheduling.Quartz.xml
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ ├── Spring.Services.xml
│ │ ├── Spring.Template.Velocity.dll
│ │ ├── Spring.Template.Velocity.pdb
│ │ ├── Spring.Template.Velocity.xml
│ │ ├── Spring.Testing.Microsoft.dll
│ │ ├── Spring.Testing.Microsoft.pdb
│ │ ├── Spring.Testing.Microsoft.xml
│ │ ├── Spring.Testing.NUnit.dll
│ │ ├── Spring.Testing.NUnit.pdb
│ │ ├── Spring.Testing.NUnit.xml
│ │ ├── Spring.Web.dll
│ │ ├── Spring.Web.Extensions.dll
│ │ ├── Spring.Web.Extensions.pdb
│ │ ├── Spring.Web.Extensions.xml
│ │ ├── Spring.Web.pdb
│ │ └── Spring.Web.xml
│ ├── 3.0
│ │ ├── debug
│ │ │ ├── readme-net-3.0.txt
│ │ │ ├── Spring.Services.dll
│ │ │ ├── Spring.Services.pdb
│ │ │ └── Spring.Services.xml
│ │ └── release
│ │ ├── readme-net-3.0.txt
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ └── Spring.Services.xml
│ ├── 3.5
│ │ ├── debug
│ │ │ ├── readme-net-3.5.txt
│ │ │ ├── Spring.Data.NHibernate30.dll
│ │ │ ├── Spring.Data.NHibernate30.pdb
│ │ │ ├── Spring.Data.NHibernate30.xml
│ │ │ ├── Spring.Data.NHibernate31.dll
│ │ │ ├── Spring.Data.NHibernate31.pdb
│ │ │ ├── Spring.Data.NHibernate31.xml
│ │ │ ├── Spring.Data.NHibernate32.dll
│ │ │ ├── Spring.Data.NHibernate32.pdb
│ │ │ ├── Spring.Data.NHibernate32.xml
│ │ │ ├── Spring.Scheduling.Quartz.dll
│ │ │ ├── Spring.Scheduling.Quartz.pdb
│ │ │ ├── Spring.Scheduling.Quartz.xml
│ │ │ ├── Spring.Services.dll
│ │ │ ├── Spring.Services.pdb
│ │ │ ├── Spring.Services.xml
│ │ │ ├── Spring.Web.Extensions.dll
│ │ │ ├── Spring.Web.Extensions.pdb
│ │ │ ├── Spring.Web.Extensions.xml
│ │ │ ├── Spring.Web.Mvc.dll
│ │ │ ├── Spring.Web.Mvc.pdb
│ │ │ └── Spring.Web.Mvc.xml
│ │ └── release
│ │ ├── readme-net-3.5.txt
│ │ ├── Spring.Data.NHibernate30.dll
│ │ ├── Spring.Data.NHibernate30.pdb
│ │ ├── Spring.Data.NHibernate30.xml
│ │ ├── Spring.Data.NHibernate31.dll
│ │ ├── Spring.Data.NHibernate31.pdb
│ │ ├── Spring.Data.NHibernate31.xml
│ │ ├── Spring.Data.NHibernate32.dll
│ │ ├── Spring.Data.NHibernate32.pdb
│ │ ├── Spring.Data.NHibernate32.xml
│ │ ├── Spring.Scheduling.Quartz.dll
│ │ ├── Spring.Scheduling.Quartz.pdb
│ │ ├── Spring.Scheduling.Quartz.xml
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ ├── Spring.Services.xml
│ │ ├── Spring.Web.Extensions.dll
│ │ ├── Spring.Web.Extensions.pdb
│ │ ├── Spring.Web.Extensions.xml
│ │ ├── Spring.Web.Mvc.dll
│ │ ├── Spring.Web.Mvc.pdb
│ │ └── Spring.Web.Mvc.xml
│ └── 4.0
│ ├── debug
│ │ ├── Common.Logging.dll
│ │ ├── Spring.Aop.dll
│ │ ├── Spring.Aop.pdb
│ │ ├── Spring.Aop.xml
│ │ ├── Spring.Core.dll
│ │ ├── Spring.Core.pdb
│ │ ├── Spring.Core.xml
│ │ ├── Spring.Data.dll
│ │ ├── Spring.Data.NHibernate20.dll
│ │ ├── Spring.Data.NHibernate20.pdb
│ │ ├── Spring.Data.NHibernate20.xml
│ │ ├── Spring.Data.NHibernate21.dll
│ │ ├── Spring.Data.NHibernate21.pdb
│ │ ├── Spring.Data.NHibernate21.xml
│ │ ├── Spring.Data.NHibernate30.dll
│ │ ├── Spring.Data.NHibernate30.pdb
│ │ ├── Spring.Data.NHibernate30.xml
│ │ ├── Spring.Data.NHibernate31.dll
│ │ ├── Spring.Data.NHibernate31.pdb
│ │ ├── Spring.Data.NHibernate31.xml
│ │ ├── Spring.Data.NHibernate32.dll
│ │ ├── Spring.Data.NHibernate32.pdb
│ │ ├── Spring.Data.NHibernate32.xml
│ │ ├── Spring.Data.pdb
│ │ ├── Spring.Data.xml
│ │ ├── Spring.Messaging.dll
│ │ ├── Spring.Messaging.Ems.dll
│ │ ├── Spring.Messaging.Ems.pdb
│ │ ├── Spring.Messaging.Ems.xml
│ │ ├── Spring.Messaging.Nms.dll
│ │ ├── Spring.Messaging.Nms.pdb
│ │ ├── Spring.Messaging.Nms.xml
│ │ ├── Spring.Messaging.pdb
│ │ ├── Spring.Messaging.xml
│ │ ├── Spring.Scheduling.Quartz.dll
│ │ ├── Spring.Scheduling.Quartz.pdb
│ │ ├── Spring.Scheduling.Quartz.xml
│ │ ├── Spring.Services.dll
│ │ ├── Spring.Services.pdb
│ │ ├── Spring.Services.xml
│ │ ├── Spring.Template.Velocity.dll
│ │ ├── Spring.Template.Velocity.pdb
│ │ ├── Spring.Template.Velocity.xml
│ │ ├── Spring.Testing.Microsoft.dll
│ │ ├── Spring.Testing.Microsoft.pdb
│ │ ├── Spring.Testing.Microsoft.xml
│ │ ├── Spring.Testing.NUnit.dll
│ │ ├── Spring.Testing.NUnit.pdb
│ │ ├── Spring.Testing.NUnit.xml
│ │ ├── Spring.Web.dll
│ │ ├── Spring.Web.Extensions.dll
│ │ ├── Spring.Web.Extensions.pdb
│ │ ├── Spring.Web.Extensions.xml
│ │ ├── Spring.Web.Mvc3.dll
│ │ ├── Spring.Web.Mvc3.pdb
│ │ ├── Spring.Web.Mvc3.xml
│ │ ├── Spring.Web.Mvc.dll
│ │ ├── Spring.Web.Mvc.pdb
│ │ ├── Spring.Web.Mvc.xml
│ │ ├── Spring.Web.pdb
│ │ └── Spring.Web.xml
│ └── release
│ ├── Common.Logging.dll
│ ├── Spring.Aop.dll
│ ├── Spring.Aop.pdb
│ ├── Spring.Aop.xml
│ ├── Spring.Core.dll
│ ├── Spring.Core.pdb
│ ├── Spring.Core.xml
│ ├── Spring.Data.dll
│ ├── Spring.Data.NHibernate20.dll
│ ├── Spring.Data.NHibernate20.pdb
│ ├── Spring.Data.NHibernate20.xml
│ ├── Spring.Data.NHibernate21.dll
│ ├── Spring.Data.NHibernate21.pdb
│ ├── Spring.Data.NHibernate21.xml
│ ├── Spring.Data.NHibernate30.dll
│ ├── Spring.Data.NHibernate30.pdb
│ ├── Spring.Data.NHibernate30.xml
│ ├── Spring.Data.NHibernate31.dll
│ ├── Spring.Data.NHibernate31.pdb
│ ├── Spring.Data.NHibernate31.xml
│ ├── Spring.Data.NHibernate32.dll
│ ├── Spring.Data.NHibernate32.pdb
│ ├── Spring.Data.NHibernate32.xml
│ ├── Spring.Data.pdb
│ ├── Spring.Data.xml
│ ├── Spring.Messaging.dll
│ ├── Spring.Messaging.Ems.dll
│ ├── Spring.Messaging.Ems.pdb
│ ├── Spring.Messaging.Ems.xml
│ ├── Spring.Messaging.Nms.dll
│ ├── Spring.Messaging.Nms.pdb
│ ├── Spring.Messaging.Nms.xml
│ ├── Spring.Messaging.pdb
│ ├── Spring.Messaging.xml
│ ├── Spring.Scheduling.Quartz.dll
│ ├── Spring.Scheduling.Quartz.pdb
│ ├── Spring.Scheduling.Quartz.xml
│ ├── Spring.Services.dll
│ ├── Spring.Services.pdb
│ ├── Spring.Services.xml
│ ├── Spring.Template.Velocity.dll
│ ├── Spring.Template.Velocity.pdb
│ ├── Spring.Template.Velocity.xml
│ ├── Spring.Testing.Microsoft.dll
│ ├── Spring.Testing.Microsoft.pdb
│ ├── Spring.Testing.Microsoft.xml
│ ├── Spring.Testing.NUnit.dll
│ ├── Spring.Testing.NUnit.pdb
│ ├── Spring.Testing.NUnit.xml
│ ├── Spring.Web.dll
│ ├── Spring.Web.Extensions.dll
│ ├── Spring.Web.Extensions.pdb
│ ├── Spring.Web.Extensions.xml
│ ├── Spring.Web.Mvc3.dll
│ ├── Spring.Web.Mvc3.pdb
│ ├── Spring.Web.Mvc3.xml
│ ├── Spring.Web.Mvc.dll
│ ├── Spring.Web.Mvc.pdb
│ ├── Spring.Web.Mvc.xml
│ ├── Spring.Web.pdb
│ └── Spring.Web.xml
├── BreakingChanges.txt
├── build-support
│ ├── icons
│ │ ├── spring16.ico
│ │ ├── spring32-16.ico
│ │ ├── spring32.ico
│ │ ├── spring.ico
│ │ └── spring.pal
│ ├── solutions
│ │ ├── Spring.Net.Core.2008.sln
│ │ ├── Spring.Net.Messaging.Ems.2005.sln
│ │ ├── Spring.Net.Messaging.Ems.2008.sln
│ │ ├── Spring.Net.Messaging.Nms.2008.sln
│ │ ├── Spring.Net.NHibernate20.2005.sln
│ │ ├── Spring.Net.NHibernate20.2008.sln
│ │ ├── Spring.Net.NHibernate21.2005.sln
│ │ ├── Spring.Net.NHibernate21.2008.sln
│ │ ├── Spring.Net.NHibernate30.2008.sln
│ │ ├── Spring.Net.NHibernate31.2008.sln
│ │ ├── Spring.Net.NHibernate.sln
│ │ ├── Spring.Net.Quartz.2005.sln
│ │ ├── Spring.Net.Quartz.2008.sln
│ │ ├── Spring.Net.Template.2008.sln
│ │ └── Spring.Net.Testing.2008.sln
│ ├── solutions.build.nant
│ └── tools
│ ├── antlr-2.7.6
│ │ ├── antlr-2.7.6.exe
│ │ ├── antlr.jar
│ │ ├── charset.dll
│ │ └── libiconv-2.dll
│ ├── ncover
│ │ ├── Coverage.xsl
│ │ ├── CoverLib.dll
│ │ ├── Microsoft.VC80.CRT.manifest
│ │ ├── MSVCP80.dll
│ │ ├── MSVCR80.dll
│ │ ├── NCover.Console.exe
│ │ ├── NCover.Console.exe.config
│ │ ├── NCoverFAQ.html
│ │ └── NCover.Framework.dll
│ ├── ncoverexplorer
│ │ ├── ActiproEULA.html
│ │ ├── ActiproSoftware.Shared.Net11.dll
│ │ ├── ActiproSoftware.SyntaxEditor.Net11.dll
│ │ ├── ActiproSoftware.WinUICore.Net11.dll
│ │ ├── CommandBars.dll
│ │ ├── ConsoleConfig.xsd
│ │ ├── ConsoleExample.config
│ │ ├── CoverageReport.xsl
│ │ ├── CoverageReport.xsl.original
│ │ ├── LicencePersonal.rtf
│ │ ├── NCoverExplorer.Console.exe
│ │ ├── NCoverExplorer.Core.dll
│ │ ├── NCoverExplorer.exe
│ │ ├── NCoverExplorer.exe.config
│ │ ├── NCoverExplorerFAQ.html
│ │ ├── NCoverExplorer.NAntTasks.dll
│ │ ├── NCoverExplorer.NCoverRunner.dll
│ │ ├── NCoverExplorerReleaseNotes.html
│ │ └── NCoverExplorer.WinForms.dll
│ ├── ndoc3
│ │ ├── Interop.MSHelpCompiler.dll
│ │ ├── NDoc3Console.exe
│ │ ├── NDoc3Console.pdb
│ │ ├── NDoc3.Core.dll
│ │ ├── NDoc3.Core.pdb
│ │ ├── NDoc3.Documenter.Msdn.dll
│ │ ├── NDoc3.Documenter.Msdn.pdb
│ │ ├── NDoc3.Documenter.Xml.dll
│ │ ├── NDoc3.Documenter.Xml.pdb
│ │ ├── NDoc3.ExtendedUI.dll
│ │ ├── NDoc3.ExtendedUI.pdb
│ │ ├── NDoc3Gui.exe
│ │ ├── NDoc3Gui.exe.manifest
│ │ └── NDoc3Gui.pdb
│ └── nunit
│ ├── net-1.1
│ │ ├── agent.conf
│ │ ├── agent.log.conf
│ │ ├── framework
│ │ │ ├── nunit.framework.dll
│ │ │ ├── nunit.framework.xml
│ │ │ ├── nunit.mocks.dll
│ │ │ └── pnunit.framework.dll
│ │ ├── launcher.log.conf
│ │ ├── lib
│ │ │ ├── fit.dll
│ │ │ ├── log4net.dll
│ │ │ ├── nunit-console-runner.dll
│ │ │ ├── nunit.core.dll
│ │ │ ├── nunit.core.interfaces.dll
│ │ │ ├── nunit.fixtures.dll
│ │ │ └── nunit.util.dll
│ │ ├── nunit-agent.exe
│ │ ├── nunit-agent.exe.config
│ │ ├── nunit-console.exe
│ │ ├── nunit-console.exe.config
│ │ ├── NUnitFitTests.html
│ │ ├── nunit.framework.dll
│ │ ├── NUnitTests.config
│ │ ├── NUnitTests.nunit
│ │ ├── pnunit-agent.exe
│ │ ├── pnunit-agent.exe.config
│ │ ├── pnunit.framework.dll
│ │ ├── pnunit-launcher.exe
│ │ ├── pnunit-launcher.exe.config
│ │ ├── pnunit.tests.dll
│ │ ├── runFile.exe
│ │ ├── runFile.exe.config
│ │ ├── runpnunit.bat
│ │ ├── test.conf
│ │ └── tests
│ │ ├── loadtest-assembly.dll
│ │ ├── mock-assembly.dll
│ │ ├── nonamespace-assembly.dll
│ │ ├── nunit-console.tests.dll
│ │ ├── nunit.core.tests.dll
│ │ ├── nunit.fixtures.tests.dll
│ │ ├── nunit.framework.dll
│ │ ├── nunit.framework.tests.dll
│ │ ├── nunit.mocks.tests.dll
│ │ ├── nunit.util.tests.dll
│ │ ├── test-assembly.dll
│ │ ├── test-utilities.dll
│ │ └── timing-tests.dll
│ └── net-2.0
│ ├── agent.conf
│ ├── agent.log.conf
│ ├── framework
│ │ ├── nunit.framework.dll
│ │ ├── nunit.framework.xml
│ │ ├── nunit.mocks.dll
│ │ └── pnunit.framework.dll
│ ├── launcher.log.conf
│ ├── lib
│ │ ├── Failure.png
│ │ ├── fit.dll
│ │ ├── Ignored.png
│ │ ├── Inconclusive.png
│ │ ├── log4net.dll
│ │ ├── nunit-console-runner.dll
│ │ ├── nunit.core.dll
│ │ ├── nunit.core.interfaces.dll
│ │ ├── nunit.fixtures.dll
│ │ ├── nunit-gui-runner.dll
│ │ ├── nunit.uiexception.dll
│ │ ├── nunit.uikit.dll
│ │ ├── nunit.util.dll
│ │ ├── Skipped.png
│ │ └── Success.png
│ ├── nunit-agent.exe
│ ├── nunit-agent.exe.config
│ ├── nunit-agent-x86.exe
│ ├── nunit-agent-x86.exe.config
│ ├── nunit-console.exe
│ ├── nunit-console.exe.config
│ ├── nunit-console-x86.exe
│ ├── nunit-console-x86.exe.config
│ ├── nunit.exe
│ ├── nunit.exe.config
│ ├── NUnitFitTests.html
│ ├── nunit.framework.dll
│ ├── NUnitTests.config
│ ├── NUnitTests.nunit
│ ├── nunit-x86.exe
│ ├── nunit-x86.exe.config
│ ├── pnunit-agent.exe
│ ├── pnunit-agent.exe.config
│ ├── pnunit.framework.dll
│ ├── pnunit-launcher.exe
│ ├── pnunit-launcher.exe.config
│ ├── pnunit.tests.dll
│ ├── runFile.exe
│ ├── runFile.exe.config
│ ├── runpnunit.bat
│ ├── test.conf
│ └── tests
│ ├── loadtest-assembly.dll
│ ├── mock-assembly.dll
│ ├── nonamespace-assembly.dll
│ ├── nunit-console.tests.dll
│ ├── nunit.core.tests.dll
│ ├── nunit.fixtures.tests.dll
│ ├── nunit.framework.dll
│ ├── nunit.framework.tests.dll
│ ├── nunit-gui.tests.dll
│ ├── nunit.mocks.tests.dll
│ ├── nunit.uiexception.tests.dll
│ ├── nunit.uikit.tests.dll
│ ├── nunit.util.tests.dll
│ ├── test-assembly.dll
│ ├── test-utilities.dll
│ └── timing-tests.dll
├── changelog.txt
├── common-project.include
├── dev-support
│ ├── resharper
│ │ ├── install.txt
│ │ ├── spring_r#_file-templates.xml
│ │ └── spring_r#_live-templates.xml
│ └── vs.net-2008
│ ├── install-templates.bat
│ └── templates
│ ├── item
│ │ └── ObjectDefinitionFile.zip
│ ├── project
│ │ └── SpringClassLibrary.zip
│ └── solution
│ ├── AdoSolution
│ │ ├── ADO.NET Class Library.msi
│ │ ├── ADO.NET Class Library.wixpdb
│ │ └── ADO.NET Class Library.zip
│ ├── ClassLibrarySolution
│ │ └── Class Library.zip
│ ├── NHibernateSolution
│ │ └── NHibernate Class Library.zip
│ └── WebSolution
│ └── ASP.NET Application.zip
├── doc
│ ├── reference
│ │ ├── html
│ │ │ ├── ado.html
│ │ │ ├── ajax.html
│ │ │ ├── aop-aspect-library.html
│ │ │ ├── aop.html
│ │ │ ├── aop-quickstart.html
│ │ │ ├── background.html
│ │ │ ├── classic-spring.html
│ │ │ ├── dao.html
│ │ │ ├── data-quickstart.html
│ │ │ ├── dbprovider.html
│ │ │ ├── ems-quickstart.html
│ │ │ ├── expressions.html
│ │ │ ├── extensible-xml.html
│ │ │ ├── images
│ │ │ │ ├── admons
│ │ │ │ │ ├── annot-close.png
│ │ │ │ │ ├── annot-open.png
│ │ │ │ │ ├── blank.png
│ │ │ │ │ ├── caution.gif
│ │ │ │ │ ├── caution.png
│ │ │ │ │ ├── caution.svg
│ │ │ │ │ ├── caution.tif
│ │ │ │ │ ├── draft.png
│ │ │ │ │ ├── home.gif
│ │ │ │ │ ├── home.png
│ │ │ │ │ ├── home.svg
│ │ │ │ │ ├── important.gif
│ │ │ │ │ ├── important.png
│ │ │ │ │ ├── important.svg
│ │ │ │ │ ├── important.tif
│ │ │ │ │ ├── next.gif
│ │ │ │ │ ├── next.png
│ │ │ │ │ ├── next.svg
│ │ │ │ │ ├── note.gif
│ │ │ │ │ ├── note.png
│ │ │ │ │ ├── note.svg
│ │ │ │ │ ├── note.tif
│ │ │ │ │ ├── prev.gif
│ │ │ │ │ ├── prev.png
│ │ │ │ │ ├── prev.svg
│ │ │ │ │ ├── Thumbs.db
│ │ │ │ │ ├── tip.gif
│ │ │ │ │ ├── tip.png
│ │ │ │ │ ├── tip.svg
│ │ │ │ │ ├── tip.tif
│ │ │ │ │ ├── toc-blank.png
│ │ │ │ │ ├── toc-minus.png
│ │ │ │ │ ├── toc-plus.png
│ │ │ │ │ ├── up.gif
│ │ │ │ │ ├── up.png
│ │ │ │ │ ├── up.svg
│ │ │ │ │ ├── warning.gif
│ │ │ │ │ ├── warning.png
│ │ │ │ │ ├── warning.svg
│ │ │ │ │ └── warning.tif
│ │ │ │ ├── aop-chain.png
│ │ │ │ ├── aop-uml.gif
│ │ │ │ ├── bean-lifecycle-overview.gif
│ │ │ │ ├── callouts
│ │ │ │ │ ├── 10.gif
│ │ │ │ │ ├── 10.png
│ │ │ │ │ ├── 10.svg
│ │ │ │ │ ├── 11.gif
│ │ │ │ │ ├── 11.png
│ │ │ │ │ ├── 11.svg
│ │ │ │ │ ├── 12.gif
│ │ │ │ │ ├── 12.png
│ │ │ │ │ ├── 12.svg
│ │ │ │ │ ├── 13.gif
│ │ │ │ │ ├── 13.png
│ │ │ │ │ ├── 13.svg
│ │ │ │ │ ├── 14.gif
│ │ │ │ │ ├── 14.png
│ │ │ │ │ ├── 14.svg
│ │ │ │ │ ├── 15.gif
│ │ │ │ │ ├── 15.png
│ │ │ │ │ ├── 15.svg
│ │ │ │ │ ├── 16.svg
│ │ │ │ │ ├── 17.svg
│ │ │ │ │ ├── 18.svg
│ │ │ │ │ ├── 19.svg
│ │ │ │ │ ├── 1.gif
│ │ │ │ │ ├── 1.png
│ │ │ │ │ ├── 1.svg
│ │ │ │ │ ├── 20.svg
│ │ │ │ │ ├── 21.svg
│ │ │ │ │ ├── 22.svg
│ │ │ │ │ ├── 23.svg
│ │ │ │ │ ├── 24.svg
│ │ │ │ │ ├── 25.svg
│ │ │ │ │ ├── 26.svg
│ │ │ │ │ ├── 27.svg
│ │ │ │ │ ├── 28.svg
│ │ │ │ │ ├── 29.svg
│ │ │ │ │ ├── 2.gif
│ │ │ │ │ ├── 2.png
│ │ │ │ │ ├── 2.svg
│ │ │ │ │ ├── 30.svg
│ │ │ │ │ ├── 3.gif
│ │ │ │ │ ├── 3.png
│ │ │ │ │ ├── 3.svg
│ │ │ │ │ ├── 4.gif
│ │ │ │ │ ├── 4.png
│ │ │ │ │ ├── 4.svg
│ │ │ │ │ ├── 5.gif
│ │ │ │ │ ├── 5.png
│ │ │ │ │ ├── 5.svg
│ │ │ │ │ ├── 6.gif
│ │ │ │ │ ├── 6.png
│ │ │ │ │ ├── 6.svg
│ │ │ │ │ ├── 7.gif
│ │ │ │ │ ├── 7.png
│ │ │ │ │ ├── 7.svg
│ │ │ │ │ ├── 8.gif
│ │ │ │ │ ├── 8.png
│ │ │ │ │ ├── 8.svg
│ │ │ │ │ ├── 9.gif
│ │ │ │ │ ├── 9.png
│ │ │ │ │ ├── 9.svg
│ │ │ │ │ └── Thumbs.db
│ │ │ │ ├── container-in-action.gif
│ │ │ │ ├── DataAccessException.gif
│ │ │ │ ├── link.png
│ │ │ │ ├── logo.gif
│ │ │ │ ├── logo.jpg
│ │ │ │ ├── logo.png
│ │ │ │ ├── movie-finder.gif
│ │ │ │ ├── nh-quickstart-customer-listing.png
│ │ │ │ ├── nh-quickstart-default-screen.png
│ │ │ │ ├── nh-quickstart-domain.png
│ │ │ │ ├── nh-quickstart-edit-customer.png
│ │ │ │ ├── nh-quickstart-orders.png
│ │ │ │ ├── nh-quickstart-process.png
│ │ │ │ ├── nh-quickstart-solution-explorer.png
│ │ │ │ ├── nms-quickstart-gui.png
│ │ │ │ ├── nms-quickstart.jpg
│ │ │ │ ├── nms-quickstart-msg-destinations.jpg
│ │ │ │ ├── overview.gif
│ │ │ │ ├── remoting-solution.gif
│ │ │ │ ├── remoting-startup.gif
│ │ │ │ ├── resharper-file-templates.png
│ │ │ │ ├── resharper-live-prop-def.png
│ │ │ │ ├── resharper-live-templates.png
│ │ │ │ ├── resharper-property-ref-1.png
│ │ │ │ ├── resharper-property-ref-2.png
│ │ │ │ ├── resharper-property-ref-3.png
│ │ │ │ ├── resharper-type-completion-1.png
│ │ │ │ ├── resharper-type-completion-2.png
│ │ │ │ ├── resharper-type-completion-3.png
│ │ │ │ ├── resharper-type-completion-4.png
│ │ │ │ ├── S2-banner-rhs.png
│ │ │ │ ├── spring-triangle.png
│ │ │ │ ├── spring.windows-service.png
│ │ │ │ ├── Thumbs.db
│ │ │ │ ├── tx.png
│ │ │ │ ├── vsnet-ado-sln.png
│ │ │ │ ├── vsnet-classlib-sln.png
│ │ │ │ ├── vsnet-nh-sln.png
│ │ │ │ ├── vsnet-solution-templates.png
│ │ │ │ ├── vsnet-web-sln.png
│ │ │ │ ├── web-exporter-calc-svc-aop-add001.jpg
│ │ │ │ ├── web-exporter-calc-svc-aop-add.jpg
│ │ │ │ ├── web-exporter-calc-svc-aop.jpg
│ │ │ │ ├── web-exporter-calc-svc.jpg
│ │ │ │ ├── web-exporter-calc-svc-main.jpg
│ │ │ │ └── xdev-spring_logo.jpg
│ │ │ ├── index.html
│ │ │ ├── introduction.html
│ │ │ ├── javadevelopers.html
│ │ │ ├── logging.html
│ │ │ ├── messaging-ems.html
│ │ │ ├── messaging.html
│ │ │ ├── migration.html
│ │ │ ├── misc.html
│ │ │ ├── msmq.html
│ │ │ ├── msmq-quickstart.html
│ │ │ ├── nh-quickstart.html
│ │ │ ├── nms-quickstart.html
│ │ │ ├── objects.html
│ │ │ ├── objects-misc.html
│ │ │ ├── orm.html
│ │ │ ├── pool.html
│ │ │ ├── preface.html
│ │ │ ├── psa-intro.html
│ │ │ ├── quartz-quickstart.html
│ │ │ ├── quickstarts.html
│ │ │ ├── remoting.html
│ │ │ ├── remoting-quickstart.html
│ │ │ ├── resources.html
│ │ │ ├── scheduling.html
│ │ │ ├── services.html
│ │ │ ├── springair.html
│ │ │ ├── spring-appendices.html
│ │ │ ├── spring-core.html
│ │ │ ├── spring-integration.html
│ │ │ ├── spring-javadevelopers.html
│ │ │ ├── spring-middle-tier.html
│ │ │ ├── springobjectsxsd.html
│ │ │ ├── spring-quickstarts.html
│ │ │ ├── spring-services.html
│ │ │ ├── spring-vsnet.html
│ │ │ ├── spring-web.html
│ │ │ ├── styles
│ │ │ │ └── html.css
│ │ │ ├── templating.html
│ │ │ ├── testing.html
│ │ │ ├── threading.html
│ │ │ ├── transaction.html
│ │ │ ├── tx-quickstart.html
│ │ │ ├── validation.html
│ │ │ ├── vsnet.html
│ │ │ ├── wcf.html
│ │ │ ├── wcf-quickstart.html
│ │ │ ├── web.html
│ │ │ ├── web-mvc3.html
│ │ │ ├── web-mvc.html
│ │ │ ├── web-quickstart.html
│ │ │ ├── webservices.html
│ │ │ └── xsd-config.html
│ │ ├── htmlhelp
│ │ │ └── spring-net-reference.chm
│ │ └── spring-net-reference.pdf
│ ├── schema
│ │ ├── install-schema.build
│ │ ├── spring-aop-1.1.xsd
│ │ ├── spring-database-1.3.xsd
│ │ ├── spring-ems-1.3.xsd
│ │ ├── spring-nms-1.3.xsd
│ │ ├── spring-nvelocity-1.3.xsd
│ │ ├── spring-objects-1.3.xsd
│ │ ├── spring-remoting-1.1.xsd
│ │ ├── spring-tool-1.1.xsd
│ │ ├── spring-tx-1.1.xsd
│ │ ├── spring-validation-1.3.xsd
│ │ └── spring-wcf-1.3.xsd
│ └── sdk
├── examples
│ └── Spring
│ ├── SpringAir
│ │ ├── data
│ │ │ ├── access
│ │ │ │ └── readme.txt
│ │ │ ├── msde
│ │ │ │ ├── create.sql
│ │ │ │ └── populate.sql
│ │ │ ├── mysql
│ │ │ │ ├── create.sql
│ │ │ │ ├── drop.sql
│ │ │ │ ├── populate.sql
│ │ │ │ ├── readme.txt
│ │ │ │ ├── refresh.sql
│ │ │ │ └── schema.sql
│ │ │ ├── oracle
│ │ │ │ ├── create.sql
│ │ │ │ ├── drop.sql
│ │ │ │ ├── populate.sql
│ │ │ │ ├── readme.txt
│ │ │ │ ├── refresh.sql
│ │ │ │ └── schema.sql
│ │ │ └── readme.txt
│ │ ├── readme.txt
│ │ ├── SpringAir.2003.sln
│ │ ├── SpringAir.2005.sln
│ │ ├── SpringAir.2008.sln
│ │ ├── SpringAir.2010.sln
│ │ ├── SpringAir.build
│ │ ├── src
│ │ │ ├── SpringAir.Core
│ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ ├── Data
│ │ │ │ │ ├── IAircraftDao.cs
│ │ │ │ │ ├── IAirportDao.cs
│ │ │ │ │ └── IFlightDao.cs
│ │ │ │ ├── Domain
│ │ │ │ │ ├── Aircraft.cs
│ │ │ │ │ ├── AirportCollection.cs
│ │ │ │ │ ├── Airport.cs
│ │ │ │ │ ├── CabinClass.cs
│ │ │ │ │ ├── Cabin.cs
│ │ │ │ │ ├── Entity.cs
│ │ │ │ │ ├── FlightCollection.cs
│ │ │ │ │ ├── Flight.cs
│ │ │ │ │ ├── FlightSuggestions.cs
│ │ │ │ │ ├── Itinerary.cs
│ │ │ │ │ ├── Passenger.cs
│ │ │ │ │ ├── ReservationConfirmation.cs
│ │ │ │ │ ├── Reservation.cs
│ │ │ │ │ ├── Seat.cs
│ │ │ │ │ ├── TimeRange.cs
│ │ │ │ │ ├── Trip.cs
│ │ │ │ │ ├── TripMode.cs
│ │ │ │ │ └── TripPoint.cs
│ │ │ │ ├── Service
│ │ │ │ │ ├── CannotConfirmReservationException.cs
│ │ │ │ │ ├── DefaultBookingAgent.cs
│ │ │ │ │ └── IBookingAgent.cs
│ │ │ │ ├── SpringAir.Core.2003.csproj
│ │ │ │ ├── SpringAir.Core.2005.csproj
│ │ │ │ ├── SpringAir.Core.2008.csproj
│ │ │ │ ├── SpringAir.Core.2010.csproj
│ │ │ │ └── SpringAir.Core.build
│ │ │ ├── SpringAir.Data.Ado
│ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ ├── Data
│ │ │ │ │ └── Ado
│ │ │ │ │ ├── AircraftDao.cs
│ │ │ │ │ ├── AircraftMapper.cs
│ │ │ │ │ ├── AirportDao.cs
│ │ │ │ │ ├── AirportMapper.cs
│ │ │ │ │ ├── FlightDao.cs
│ │ │ │ │ └── ItineraryDao.cs
│ │ │ │ ├── SpringAir.Data.Ado.2003.csproj
│ │ │ │ ├── SpringAir.Data.Ado.2005.csproj
│ │ │ │ ├── SpringAir.Data.Ado.2008.csproj
│ │ │ │ ├── SpringAir.Data.Ado.2010.csproj
│ │ │ │ └── SpringAir.Data.Ado.build
│ │ │ ├── SpringAir.Web.2003
│ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ ├── Config
│ │ │ │ │ ├── Aspects.xml
│ │ │ │ │ ├── Log4Net.xml
│ │ │ │ │ ├── Production
│ │ │ │ │ │ ├── Dao.xml
│ │ │ │ │ │ └── Services.xml
│ │ │ │ │ ├── Services.xml
│ │ │ │ │ ├── Test
│ │ │ │ │ │ ├── Dao.xml
│ │ │ │ │ │ └── Services.xml
│ │ │ │ │ └── Web.xml
│ │ │ │ ├── Constants.cs
│ │ │ │ ├── Global.asax
│ │ │ │ ├── Global.asax.cs
│ │ │ │ ├── Global.asax.resx
│ │ │ │ ├── Resources
│ │ │ │ │ ├── Strings.en.resx
│ │ │ │ │ ├── Strings.resx
│ │ │ │ │ ├── Strings.sr-SP-Cyrl.resx
│ │ │ │ │ └── Strings.sr-SP-Latn.resx
│ │ │ │ ├── Scripts
│ │ │ │ │ └── Calendar
│ │ │ │ │ ├── calendar-blue2.css
│ │ │ │ │ ├── calendar-blue.css
│ │ │ │ │ ├── calendar-brown.css
│ │ │ │ │ ├── calendar-green.css
│ │ │ │ │ ├── calendar.js
│ │ │ │ │ ├── calendar-setup.js
│ │ │ │ │ ├── calendar-system.css
│ │ │ │ │ ├── calendar-tas.css
│ │ │ │ │ ├── calendar-win2k-1.css
│ │ │ │ │ ├── calendar-win2k-2.css
│ │ │ │ │ ├── calendar-win2k-cold-1.css
│ │ │ │ │ ├── calendar-win2k-cold-2.css
│ │ │ │ │ ├── img.gif
│ │ │ │ │ └── lang
│ │ │ │ │ ├── calendar-af.js
│ │ │ │ │ ├── calendar-al.js
│ │ │ │ │ ├── calendar-bg.js
│ │ │ │ │ ├── calendar-big5.js
│ │ │ │ │ ├── calendar-big5-utf8.js
│ │ │ │ │ ├── calendar-br.js
│ │ │ │ │ ├── calendar-ca.js
│ │ │ │ │ ├── calendar-cs-utf8.js
│ │ │ │ │ ├── calendar-cs-win.js
│ │ │ │ │ ├── calendar-da.js
│ │ │ │ │ ├── calendar-de.js
│ │ │ │ │ ├── calendar-du.js
│ │ │ │ │ ├── calendar-el.js
│ │ │ │ │ ├── calendar-en-gb.js
│ │ │ │ │ ├── calendar-en.js
│ │ │ │ │ ├── calendar-en-US.js
│ │ │ │ │ ├── calendar-es.js
│ │ │ │ │ ├── calendar-fi.js
│ │ │ │ │ ├── calendar-fr.js
│ │ │ │ │ ├── calendar-he-utf8.js
│ │ │ │ │ ├── calendar-hr.js
│ │ │ │ │ ├── calendar-hr-utf8.js
│ │ │ │ │ ├── calendar-hu.js
│ │ │ │ │ ├── calendar-it.js
│ │ │ │ │ ├── calendar-jp.js
│ │ │ │ │ ├── calendar-ko.js
│ │ │ │ │ ├── calendar-ko-utf8.js
│ │ │ │ │ ├── calendar-lt.js
│ │ │ │ │ ├── calendar-lt-utf8.js
│ │ │ │ │ ├── calendar-lv.js
│ │ │ │ │ ├── calendar-nl.js
│ │ │ │ │ ├── calendar-no.js
│ │ │ │ │ ├── calendar-pl.js
│ │ │ │ │ ├── calendar-pl-utf8.js
│ │ │ │ │ ├── calendar-pt.js
│ │ │ │ │ ├── calendar-ro.js
│ │ │ │ │ ├── calendar-ru.js
│ │ │ │ │ ├── calendar-ru_win_.js
│ │ │ │ │ ├── calendar-si.js
│ │ │ │ │ ├── calendar-sk.js
│ │ │ │ │ ├── calendar-sp.js
│ │ │ │ │ ├── calendar-sr-SP-Cyrl.js
│ │ │ │ │ ├── calendar-sr-SP-Latn.js
│ │ │ │ │ ├── calendar-sv.js
│ │ │ │ │ ├── calendar-tr.js
│ │ │ │ │ ├── calendar-zh.js
│ │ │ │ │ └── cn_utf8.js
│ │ │ │ ├── SpringAir.Web.2003.csproj
│ │ │ │ ├── SpringAir.Web.2003.csproj.webinfo
│ │ │ │ ├── SpringAir.Web.build
│ │ │ │ ├── Web
│ │ │ │ │ ├── BookTrip
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.cs
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.en.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.sr-SP-Cyrl.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.sr-SP-Latn.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.cs
│ │ │ │ │ │ ├── SuggestedFlights.aspx.resx
│ │ │ │ │ │ ├── SuggestedFlights.en.resx
│ │ │ │ │ │ ├── SuggestedFlights.sr-SP-Cyrl.resx
│ │ │ │ │ │ ├── SuggestedFlights.sr-SP-Latn.resx
│ │ │ │ │ │ ├── TripForm.aspx
│ │ │ │ │ │ ├── TripForm.aspx.cs
│ │ │ │ │ │ ├── TripForm.aspx.resx
│ │ │ │ │ │ ├── TripForm.en.resx
│ │ │ │ │ │ ├── TripForm.sr-SP-Cyrl.resx
│ │ │ │ │ │ ├── TripForm.sr-SP-Latn.resx
│ │ │ │ │ │ └── Web.config
│ │ │ │ │ ├── CSS
│ │ │ │ │ │ └── default.css
│ │ │ │ │ ├── Home.aspx
│ │ │ │ │ ├── Home.aspx.cs
│ │ │ │ │ ├── Home.aspx.resx
│ │ │ │ │ ├── Images
│ │ │ │ │ │ ├── calendar-1.gif
│ │ │ │ │ │ ├── calendar-2.gif
│ │ │ │ │ │ ├── en
│ │ │ │ │ │ │ └── spring-air-logo.jpg
│ │ │ │ │ │ ├── line.jpg
│ │ │ │ │ │ ├── panel-bottom-left.gif
│ │ │ │ │ │ ├── panel-bottom-middle.gif
│ │ │ │ │ │ ├── panel-bottom-right.gif
│ │ │ │ │ │ ├── panel-left-middle.gif
│ │ │ │ │ │ ├── panel-right-middle.gif
│ │ │ │ │ │ ├── panel-top-left.gif
│ │ │ │ │ │ ├── panel-top-middle.gif
│ │ │ │ │ │ ├── panel-top-right.gif
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ ├── sr-SP-Cyrl
│ │ │ │ │ │ │ └── spring-air-logo.jpg
│ │ │ │ │ │ ├── sr-SP-Latn
│ │ │ │ │ │ │ └── spring-air-logo.jpg
│ │ │ │ │ │ └── validation-error.gif
│ │ │ │ │ ├── StandardTemplate.ascx
│ │ │ │ │ ├── StandardTemplate.ascx.cs
│ │ │ │ │ ├── StandardTemplate.ascx.resx
│ │ │ │ │ └── Web.config
│ │ │ │ └── Web.config
│ │ │ ├── SpringAir.Web.2005
│ │ │ │ ├── App_Code
│ │ │ │ │ └── Constants.cs
│ │ │ │ ├── App_GlobalResources
│ │ │ │ │ ├── Strings.en.resx
│ │ │ │ │ ├── Strings.resx
│ │ │ │ │ ├── Strings.sr-Cyrl-CS.resx
│ │ │ │ │ ├── Strings.sr-Latn-CS.resx
│ │ │ │ │ ├── Strings.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ └── Strings.sr-SP-Latn.resx.exclude
│ │ │ │ ├── Config
│ │ │ │ │ ├── Aspects.xml
│ │ │ │ │ ├── Log4Net.xml
│ │ │ │ │ ├── Production
│ │ │ │ │ │ ├── Dao.xml
│ │ │ │ │ │ └── Services.xml
│ │ │ │ │ ├── Services.xml
│ │ │ │ │ ├── Test
│ │ │ │ │ │ ├── Dao.xml
│ │ │ │ │ │ └── Services.xml
│ │ │ │ │ ├── Validation.xml
│ │ │ │ │ └── Web.xml
│ │ │ │ ├── Global.asax
│ │ │ │ ├── Scripts
│ │ │ │ │ └── Calendar
│ │ │ │ │ ├── calendar-blue2.css
│ │ │ │ │ ├── calendar-blue.css
│ │ │ │ │ ├── calendar-brown.css
│ │ │ │ │ ├── calendar-green.css
│ │ │ │ │ ├── calendar.js
│ │ │ │ │ ├── calendar-setup.js
│ │ │ │ │ ├── calendar-system.css
│ │ │ │ │ ├── calendar-tas.css
│ │ │ │ │ ├── calendar-win2k-1.css
│ │ │ │ │ ├── calendar-win2k-2.css
│ │ │ │ │ ├── calendar-win2k-cold-1.css
│ │ │ │ │ ├── calendar-win2k-cold-2.css
│ │ │ │ │ ├── img.gif
│ │ │ │ │ └── lang
│ │ │ │ │ ├── calendar-af.js
│ │ │ │ │ ├── calendar-al.js
│ │ │ │ │ ├── calendar-bg.js
│ │ │ │ │ ├── calendar-big5.js
│ │ │ │ │ ├── calendar-big5-utf8.js
│ │ │ │ │ ├── calendar-br.js
│ │ │ │ │ ├── calendar-ca.js
│ │ │ │ │ ├── calendar-cs-utf8.js
│ │ │ │ │ ├── calendar-cs-win.js
│ │ │ │ │ ├── calendar-da.js
│ │ │ │ │ ├── calendar-de.js
│ │ │ │ │ ├── calendar-du.js
│ │ │ │ │ ├── calendar-el.js
│ │ │ │ │ ├── calendar-en-gb.js
│ │ │ │ │ ├── calendar-en.js
│ │ │ │ │ ├── calendar-en-US.js
│ │ │ │ │ ├── calendar-es.js
│ │ │ │ │ ├── calendar-fi.js
│ │ │ │ │ ├── calendar-fr.js
│ │ │ │ │ ├── calendar-he-utf8.js
│ │ │ │ │ ├── calendar-hr.js
│ │ │ │ │ ├── calendar-hr-utf8.js
│ │ │ │ │ ├── calendar-hu.js
│ │ │ │ │ ├── calendar-it.js
│ │ │ │ │ ├── calendar-jp.js
│ │ │ │ │ ├── calendar-ko.js
│ │ │ │ │ ├── calendar-ko-utf8.js
│ │ │ │ │ ├── calendar-lt.js
│ │ │ │ │ ├── calendar-lt-utf8.js
│ │ │ │ │ ├── calendar-lv.js
│ │ │ │ │ ├── calendar-nl.js
│ │ │ │ │ ├── calendar-no.js
│ │ │ │ │ ├── calendar-pl.js
│ │ │ │ │ ├── calendar-pl-utf8.js
│ │ │ │ │ ├── calendar-pt.js
│ │ │ │ │ ├── calendar-ro.js
│ │ │ │ │ ├── calendar-ru.js
│ │ │ │ │ ├── calendar-ru_win_.js
│ │ │ │ │ ├── calendar-si.js
│ │ │ │ │ ├── calendar-sk.js
│ │ │ │ │ ├── calendar-sp.js
│ │ │ │ │ ├── calendar-sr-SP-Cyrl.js
│ │ │ │ │ ├── calendar-sr-SP-Latn.js
│ │ │ │ │ ├── calendar-sv.js
│ │ │ │ │ ├── calendar-tr.js
│ │ │ │ │ ├── calendar-zh.js
│ │ │ │ │ └── cn_utf8.js
│ │ │ │ ├── SpringAir.Web.build
│ │ │ │ ├── Web
│ │ │ │ │ ├── App_LocalResources
│ │ │ │ │ │ ├── Home.aspx.resx
│ │ │ │ │ │ └── StandardTemplate.master.resx
│ │ │ │ │ ├── BookTrip
│ │ │ │ │ │ ├── App_LocalResources
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.en.resx
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.resx
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.en.resx
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.resx
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ │ ├── TripForm.aspx.en.resx
│ │ │ │ │ │ │ ├── TripForm.aspx.resx
│ │ │ │ │ │ │ ├── TripForm.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ │ ├── TripForm.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ │ ├── TripForm.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ │ └── TripForm.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ ├── BookTrip.aspx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.cs
│ │ │ │ │ │ ├── SuggestedFlights.aspx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.cs
│ │ │ │ │ │ ├── TripForm.aspx
│ │ │ │ │ │ ├── TripForm.aspx.cs
│ │ │ │ │ │ └── Web.config
│ │ │ │ │ ├── CSS
│ │ │ │ │ │ └── default.css
│ │ │ │ │ ├── Home.aspx
│ │ │ │ │ ├── Home.aspx.cs
│ │ │ │ │ ├── Images
│ │ │ │ │ │ ├── calendar-1.gif
│ │ │ │ │ │ ├── calendar-2.gif
│ │ │ │ │ │ ├── en
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── error.gif
│ │ │ │ │ │ ├── line.jpg
│ │ │ │ │ │ ├── panel-bottom-left.gif
│ │ │ │ │ │ ├── panel-bottom-middle.gif
│ │ │ │ │ │ ├── panel-bottom-right.gif
│ │ │ │ │ │ ├── panel-left-middle.gif
│ │ │ │ │ │ ├── panel-right-middle.gif
│ │ │ │ │ │ ├── panel-top-left.gif
│ │ │ │ │ │ ├── panel-top-middle.gif
│ │ │ │ │ │ ├── panel-top-right.gif
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ ├── sr-Cyrl-CS
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── sr-Latn-CS
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── sr-SP-Cyrl
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── sr-SP-Latn
│ │ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ │ ├── Thumbs.db
│ │ │ │ │ │ └── validation-error.gif
│ │ │ │ │ ├── StandardTemplate.master
│ │ │ │ │ ├── StandardTemplate.master.cs
│ │ │ │ │ └── Web.config
│ │ │ │ └── Web.config
│ │ │ ├── SpringAir.Web.2005.References
│ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ ├── SpringAir.Web.2005.References.csproj
│ │ │ │ ├── SpringAir.Web.2008.References.csproj
│ │ │ │ └── SpringAir.Web.2010.References.csproj
│ │ │ └── SpringAir.Web.2010
│ │ │ ├── App_Code
│ │ │ │ └── Constants.cs
│ │ │ ├── App_GlobalResources
│ │ │ │ ├── Strings.en.resx
│ │ │ │ ├── Strings.resx
│ │ │ │ ├── Strings.sr-Cyrl-CS.resx
│ │ │ │ ├── Strings.sr-Latn-CS.resx
│ │ │ │ ├── Strings.sr-SP-Cyrl.resx.exclude
│ │ │ │ └── Strings.sr-SP-Latn.resx.exclude
│ │ │ ├── Config
│ │ │ │ ├── Aspects.xml
│ │ │ │ ├── Log4Net.xml
│ │ │ │ ├── Production
│ │ │ │ │ ├── Dao.xml
│ │ │ │ │ └── Services.xml
│ │ │ │ ├── Services.xml
│ │ │ │ ├── Test
│ │ │ │ │ ├── Dao.xml
│ │ │ │ │ └── Services.xml
│ │ │ │ ├── Validation.xml
│ │ │ │ └── Web.xml
│ │ │ ├── Global.asax
│ │ │ ├── Scripts
│ │ │ │ └── Calendar
│ │ │ │ ├── calendar-blue2.css
│ │ │ │ ├── calendar-blue.css
│ │ │ │ ├── calendar-brown.css
│ │ │ │ ├── calendar-green.css
│ │ │ │ ├── calendar.js
│ │ │ │ ├── calendar-setup.js
│ │ │ │ ├── calendar-system.css
│ │ │ │ ├── calendar-tas.css
│ │ │ │ ├── calendar-win2k-1.css
│ │ │ │ ├── calendar-win2k-2.css
│ │ │ │ ├── calendar-win2k-cold-1.css
│ │ │ │ ├── calendar-win2k-cold-2.css
│ │ │ │ ├── img.gif
│ │ │ │ └── lang
│ │ │ │ ├── calendar-af.js
│ │ │ │ ├── calendar-al.js
│ │ │ │ ├── calendar-bg.js
│ │ │ │ ├── calendar-big5.js
│ │ │ │ ├── calendar-big5-utf8.js
│ │ │ │ ├── calendar-br.js
│ │ │ │ ├── calendar-ca.js
│ │ │ │ ├── calendar-cs-utf8.js
│ │ │ │ ├── calendar-cs-win.js
│ │ │ │ ├── calendar-da.js
│ │ │ │ ├── calendar-de.js
│ │ │ │ ├── calendar-du.js
│ │ │ │ ├── calendar-el.js
│ │ │ │ ├── calendar-en-gb.js
│ │ │ │ ├── calendar-en.js
│ │ │ │ ├── calendar-en-US.js
│ │ │ │ ├── calendar-es.js
│ │ │ │ ├── calendar-fi.js
│ │ │ │ ├── calendar-fr.js
│ │ │ │ ├── calendar-he-utf8.js
│ │ │ │ ├── calendar-hr.js
│ │ │ │ ├── calendar-hr-utf8.js
│ │ │ │ ├── calendar-hu.js
│ │ │ │ ├── calendar-it.js
│ │ │ │ ├── calendar-jp.js
│ │ │ │ ├── calendar-ko.js
│ │ │ │ ├── calendar-ko-utf8.js
│ │ │ │ ├── calendar-lt.js
│ │ │ │ ├── calendar-lt-utf8.js
│ │ │ │ ├── calendar-lv.js
│ │ │ │ ├── calendar-nl.js
│ │ │ │ ├── calendar-no.js
│ │ │ │ ├── calendar-pl.js
│ │ │ │ ├── calendar-pl-utf8.js
│ │ │ │ ├── calendar-pt.js
│ │ │ │ ├── calendar-ro.js
│ │ │ │ ├── calendar-ru.js
│ │ │ │ ├── calendar-ru_win_.js
│ │ │ │ ├── calendar-si.js
│ │ │ │ ├── calendar-sk.js
│ │ │ │ ├── calendar-sp.js
│ │ │ │ ├── calendar-sr-SP-Cyrl.js
│ │ │ │ ├── calendar-sr-SP-Latn.js
│ │ │ │ ├── calendar-sv.js
│ │ │ │ ├── calendar-tr.js
│ │ │ │ ├── calendar-zh.js
│ │ │ │ └── cn_utf8.js
│ │ │ ├── SpringAir.Web.build
│ │ │ ├── Web
│ │ │ │ ├── App_LocalResources
│ │ │ │ │ ├── Home.aspx.resx
│ │ │ │ │ └── StandardTemplate.master.resx
│ │ │ │ ├── BookTrip
│ │ │ │ │ ├── App_LocalResources
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.en.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ ├── ReservationConfirmationPage.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ ├── SuggestedFlights.aspx.en.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ ├── SuggestedFlights.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ │ ├── TripForm.aspx.en.resx
│ │ │ │ │ │ ├── TripForm.aspx.resx
│ │ │ │ │ │ ├── TripForm.aspx.sr-Cyrl-CS.resx
│ │ │ │ │ │ ├── TripForm.aspx.sr-Latn-CS.resx
│ │ │ │ │ │ ├── TripForm.aspx.sr-SP-Cyrl.resx.exclude
│ │ │ │ │ │ └── TripForm.aspx.sr-SP-Latn.resx.exclude
│ │ │ │ │ ├── BookTrip.aspx
│ │ │ │ │ ├── ReservationConfirmationPage.aspx
│ │ │ │ │ ├── ReservationConfirmationPage.aspx.cs
│ │ │ │ │ ├── SuggestedFlights.aspx
│ │ │ │ │ ├── SuggestedFlights.aspx.cs
│ │ │ │ │ ├── TripForm.aspx
│ │ │ │ │ ├── TripForm.aspx.cs
│ │ │ │ │ └── Web.config
│ │ │ │ ├── CSS
│ │ │ │ │ └── default.css
│ │ │ │ ├── Home.aspx
│ │ │ │ ├── Home.aspx.cs
│ │ │ │ ├── Images
│ │ │ │ │ ├── calendar-1.gif
│ │ │ │ │ ├── calendar-2.gif
│ │ │ │ │ ├── en
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── error.gif
│ │ │ │ │ ├── line.jpg
│ │ │ │ │ ├── panel-bottom-left.gif
│ │ │ │ │ ├── panel-bottom-middle.gif
│ │ │ │ │ ├── panel-bottom-right.gif
│ │ │ │ │ ├── panel-left-middle.gif
│ │ │ │ │ ├── panel-right-middle.gif
│ │ │ │ │ ├── panel-top-left.gif
│ │ │ │ │ ├── panel-top-middle.gif
│ │ │ │ │ ├── panel-top-right.gif
│ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ ├── sr-Cyrl-CS
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── sr-Latn-CS
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── sr-SP-Cyrl
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── sr-SP-Latn
│ │ │ │ │ │ ├── spring-air-logo.jpg
│ │ │ │ │ │ └── Thumbs.db
│ │ │ │ │ ├── Thumbs.db
│ │ │ │ │ └── validation-error.gif
│ │ │ │ ├── StandardTemplate.master
│ │ │ │ ├── StandardTemplate.master.cs
│ │ │ │ └── Web.config
│ │ │ └── Web.config
│ │ └── test
│ │ ├── SpringAir.Core.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Domain
│ │ │ │ ├── FlightCollectionTests.cs
│ │ │ │ ├── FlightSuggestionsTests.cs
│ │ │ │ ├── FlightTests.cs
│ │ │ │ ├── ReservationConfirmationTests.cs
│ │ │ │ └── TimeRangeTests.cs
│ │ │ ├── Service
│ │ │ │ ├── BookingAgentIntegrationTests.cs
│ │ │ │ └── DefaultBookingAgentIntegrationTests.cs
│ │ │ ├── SpringAir.Core.Tests.2003.csproj
│ │ │ ├── SpringAir.Core.Tests.2005.csproj
│ │ │ ├── SpringAir.Core.Tests.2008.csproj
│ │ │ ├── SpringAir.Core.Tests.2010.csproj
│ │ │ └── SpringAir.Core.Tests.build
│ │ └── SpringAir.Data.Ado.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── Ado
│ │ │ ├── AircraftDaoTests.cs
│ │ │ ├── AirportDaoTests.cs
│ │ │ ├── FlightDaoTests.cs
│ │ │ └── ReflectiveDbConnectionFactoryTests.cs
│ │ ├── SpringAir.Data.Ado.Tests.2003.csproj
│ │ ├── SpringAir.Data.Ado.Tests.2005.csproj
│ │ ├── SpringAir.Data.Ado.Tests.2008.csproj
│ │ ├── SpringAir.Data.Ado.Tests.2010.csproj
│ │ └── SpringAir.Data.Ado.Tests.build
│ ├── Spring.AopQuickStart
│ │ ├── readme.txt
│ │ ├── Spring.AopQuickStart.2003.sln
│ │ ├── Spring.AopQuickStart.2005.sln
│ │ ├── Spring.AopQuickStart.2008.sln
│ │ ├── Spring.AopQuickStart.2010.sln
│ │ ├── Spring.AopQuickStart.build
│ │ └── src
│ │ ├── Spring.AopQuickStart.Common
│ │ │ ├── Aspects
│ │ │ │ ├── ConsoleLoggingAfterAdvice.cs
│ │ │ │ ├── ConsoleLoggingAroundAdvice.cs
│ │ │ │ ├── ConsoleLoggingBeforeAdvice.cs
│ │ │ │ └── ConsoleLoggingThrowsAdvice.cs
│ │ │ ├── Commands
│ │ │ │ ├── ICommand.cs
│ │ │ │ └── ServiceCommand.cs
│ │ │ ├── Spring.AopQuickStart.Common.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Common.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Common.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Common.2010.csproj
│ │ │ └── Spring.AopQuickStart.Common.build
│ │ ├── Spring.AopQuickStart.Step1
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step1.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step1.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step1.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step1.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step1.build
│ │ ├── Spring.AopQuickStart.Step2
│ │ │ ├── App.config
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step2.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step2.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step2.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step2.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step2.build
│ │ ├── Spring.AopQuickStart.Step3
│ │ │ ├── App.config
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step3.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step3.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step3.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step3.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step3.build
│ │ ├── Spring.AopQuickStart.Step4
│ │ │ ├── App.config
│ │ │ ├── Aspects
│ │ │ │ └── ConsoleLoggingAdvice.cs
│ │ │ ├── Attributes
│ │ │ │ └── ConsoleLoggingAttribute.cs
│ │ │ ├── Commands
│ │ │ │ └── AnotherServiceCommand.cs
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step4.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step4.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step4.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step4.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step4.build
│ │ ├── Spring.AopQuickStart.Step5
│ │ │ ├── App.config
│ │ │ ├── Aspects
│ │ │ │ └── ExpressionDynamicPointcutAdvisor.cs
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step5.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step5.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step5.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step5.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step5.build
│ │ ├── Spring.AopQuickStart.Step6
│ │ │ ├── App.config
│ │ │ ├── Contact.cs
│ │ │ ├── IIsModified.cs
│ │ │ ├── IsModifiedMixin.cs
│ │ │ ├── ModificationAdvice.cs
│ │ │ ├── ModificationAdvisor.cs
│ │ │ ├── Program.cs
│ │ │ ├── Spring.AopQuickStart.Step6.2003.csproj
│ │ │ ├── Spring.AopQuickStart.Step6.2005.csproj
│ │ │ ├── Spring.AopQuickStart.Step6.2008.csproj
│ │ │ ├── Spring.AopQuickStart.Step6.2010.csproj
│ │ │ └── Spring.AopQuickStart.Step6.build
│ │ └── Spring.AopQuickStart.Step7
│ │ ├── App.config
│ │ ├── Commands
│ │ │ └── AnotherServiceCommand.cs
│ │ ├── Program.cs
│ │ ├── Spring.AopQuickStart.Step7.2003.csproj
│ │ ├── Spring.AopQuickStart.Step7.2005.csproj
│ │ ├── Spring.AopQuickStart.Step7.2008.csproj
│ │ ├── Spring.AopQuickStart.Step7.2010.csproj
│ │ └── Spring.AopQuickStart.Step7.build
│ ├── Spring.CachingQuickStart
│ │ ├── Spring.CachingQuickStart.2008.sln
│ │ ├── Spring.CachingQuickStart.2010.sln
│ │ └── src
│ │ └── Spring.CachingQuickStart.Web
│ │ ├── Default.aspx
│ │ ├── Default.aspx.cs
│ │ ├── Default.aspx.designer.cs
│ │ ├── Services
│ │ │ ├── IMovieService.cs
│ │ │ ├── Movie.cs
│ │ │ └── MovieService.cs
│ │ ├── Spring.CachingQuickStart.Web.2008.csproj
│ │ ├── Spring.CachingQuickStart.Web.2010.csproj
│ │ ├── Spring.config
│ │ └── Web.config
│ ├── Spring.Calculator
│ │ ├── lib
│ │ │ └── net
│ │ │ ├── 1.1
│ │ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ │ └── log4net.dll
│ │ │ └── 2.0
│ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ └── log4net.dll
│ │ ├── readme.txt
│ │ ├── Spring.Calculator.2003.sln
│ │ ├── Spring.Calculator.2005.sln
│ │ ├── Spring.Calculator.2008.sln
│ │ ├── Spring.Calculator.2010.sln
│ │ ├── Spring.Calculator.build
│ │ ├── Spring.Calculator.snk
│ │ ├── Spring.Calculator.Web.2005
│ │ └── src
│ │ ├── Spring.Aspects
│ │ │ ├── Logging
│ │ │ │ ├── CommonLoggingAroundAdvice.cs
│ │ │ │ └── ConsoleLoggingAroundAdvice.cs
│ │ │ ├── Spring.Aspects.2003.csproj
│ │ │ ├── Spring.Aspects.2005.csproj
│ │ │ ├── Spring.Aspects.2008.csproj
│ │ │ ├── Spring.Aspects.2010.csproj
│ │ │ └── Spring.Aspects.build
│ │ ├── Spring.Calculator.ClientApp
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── EnterpriseServices
│ │ │ │ │ └── enterpriseServices.xml
│ │ │ │ ├── InProcess
│ │ │ │ │ └── inProcess.xml
│ │ │ │ ├── Remoting
│ │ │ │ │ ├── cao-aop.xml
│ │ │ │ │ ├── cao-ctor-aop.xml
│ │ │ │ │ ├── cao-ctor.xml
│ │ │ │ │ ├── cao.xml
│ │ │ │ │ ├── saoSingleCall-aop.xml
│ │ │ │ │ ├── saoSingleCall.xml
│ │ │ │ │ ├── saoSingleton-aop.xml
│ │ │ │ │ └── saoSingleton.xml
│ │ │ │ ├── WebServices
│ │ │ │ │ ├── calculatorService.wsdl
│ │ │ │ │ ├── webServices-aop.xml
│ │ │ │ │ └── webServices.xml
│ │ │ │ ├── WebServices2003
│ │ │ │ │ ├── calculatorService.wsdl
│ │ │ │ │ ├── webServices-aop.xml
│ │ │ │ │ └── webServices.xml
│ │ │ │ └── WebServices2005
│ │ │ │ ├── calculatorService.wsdl
│ │ │ │ ├── webServices-aop.xml
│ │ │ │ └── webServices.xml
│ │ │ ├── Program.cs
│ │ │ ├── Spring.Calculator.ClientApp.2003.csproj
│ │ │ ├── Spring.Calculator.ClientApp.2005.csproj
│ │ │ ├── Spring.Calculator.ClientApp.2008.csproj
│ │ │ ├── Spring.Calculator.ClientApp.2010.csproj
│ │ │ └── Spring.Calculator.ClientApp.build
│ │ ├── Spring.Calculator.Contract
│ │ │ ├── Domain
│ │ │ │ └── DivisionResult.cs
│ │ │ ├── Interfaces
│ │ │ │ ├── IAdvancedCalculator.cs
│ │ │ │ └── ICalculator.cs
│ │ │ ├── Spring.Calculator.Contract.2003.csproj
│ │ │ ├── Spring.Calculator.Contract.2005.csproj
│ │ │ ├── Spring.Calculator.Contract.2008.csproj
│ │ │ ├── Spring.Calculator.Contract.2010.csproj
│ │ │ └── Spring.Calculator.Contract.build
│ │ ├── Spring.Calculator.RegisterComponentServices
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ └── services.xml
│ │ │ ├── Program.cs
│ │ │ ├── Spring.Calculator.EnterpriseServices.dll.config
│ │ │ ├── Spring.Calculator.EnterpriseServices.exe.config
│ │ │ ├── Spring.Calculator.RegisterComponentServices.2003.csproj
│ │ │ ├── Spring.Calculator.RegisterComponentServices.2005.csproj
│ │ │ ├── Spring.Calculator.RegisterComponentServices.2008.csproj
│ │ │ ├── Spring.Calculator.RegisterComponentServices.2010.csproj
│ │ │ └── Spring.Calculator.RegisterComponentServices.build
│ │ ├── Spring.Calculator.RemoteApp
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── cao-aop.xml
│ │ │ │ ├── cao.xml
│ │ │ │ ├── saoSingleCall-aop.xml
│ │ │ │ ├── saoSingleCall.xml
│ │ │ │ ├── saoSingleton-aop.xml
│ │ │ │ └── saoSingleton.xml
│ │ │ ├── Program.cs
│ │ │ ├── Spring.Calculator.RemoteApp.2003.csproj
│ │ │ ├── Spring.Calculator.RemoteApp.2005.csproj
│ │ │ ├── Spring.Calculator.RemoteApp.2008.csproj
│ │ │ ├── Spring.Calculator.RemoteApp.2010.csproj
│ │ │ └── Spring.Calculator.RemoteApp.build
│ │ ├── Spring.Calculator.Services
│ │ │ ├── Services
│ │ │ │ ├── AdvancedCalculator.cs
│ │ │ │ └── Calculator.cs
│ │ │ ├── Spring.Calculator.Services.2003.csproj
│ │ │ ├── Spring.Calculator.Services.2005.csproj
│ │ │ ├── Spring.Calculator.Services.2008.csproj
│ │ │ ├── Spring.Calculator.Services.2010.csproj
│ │ │ └── Spring.Calculator.Services.build
│ │ ├── Spring.Calculator.Web
│ │ │ ├── Config
│ │ │ │ ├── webServices-aop.xml
│ │ │ │ └── webServices.xml
│ │ │ ├── Default.aspx
│ │ │ ├── Spring.Calculator.Web.2008.csproj
│ │ │ ├── Spring.Calculator.Web.2010.csproj
│ │ │ └── Web.config
│ │ ├── Spring.Calculator.Web.2003
│ │ │ ├── Config
│ │ │ │ ├── webServices-aop.xml
│ │ │ │ └── webServices.xml
│ │ │ ├── Default.aspx
│ │ │ ├── Spring.Calculator.Web.2003.csproj
│ │ │ ├── Spring.Calculator.Web.2003.csproj.webinfo
│ │ │ └── Web.config
│ │ └── Spring.Calculator.Web.2005
│ │ ├── App_Code
│ │ ├── Bin
│ │ │ ├── Common.Logging.dll.refresh
│ │ │ ├── Common.Logging.Log4Net.dll.refresh
│ │ │ ├── log4net.dll.refresh
│ │ │ ├── Spring.Aop.dll.refresh
│ │ │ ├── Spring.Core.dll.refresh
│ │ │ ├── Spring.Services.dll.refresh
│ │ │ └── Spring.Web.dll.refresh
│ │ ├── Config
│ │ │ ├── webServices-aop.xml
│ │ │ └── webServices.xml
│ │ ├── Default.aspx
│ │ └── Web.config
│ ├── Spring.Data.NHibernate.Northwind
│ │ ├── lib
│ │ │ └── net
│ │ │ └── 2.0
│ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ └── System.Data.SQLite.DLL
│ │ ├── readme.txt
│ │ ├── Spring.Northwind.2008.sln
│ │ ├── Spring.Northwind.2010.sln
│ │ ├── src
│ │ │ ├── Spring.Northwind.Dao
│ │ │ │ ├── Dao
│ │ │ │ │ ├── ICustomerDao.cs
│ │ │ │ │ ├── IDao.cs
│ │ │ │ │ ├── IOrderDao.cs
│ │ │ │ │ ├── IProductDao.cs
│ │ │ │ │ ├── ISupportsDeleteDao.cs
│ │ │ │ │ └── ISupportsSave.cs
│ │ │ │ ├── Domain
│ │ │ │ │ ├── Customer.cs
│ │ │ │ │ ├── DefaultCustomerClassificationCalculator.cs
│ │ │ │ │ ├── DomainClassDiagram.cd
│ │ │ │ │ ├── ICustomerClassificationCalculator.cs
│ │ │ │ │ ├── ICustomer.cs
│ │ │ │ │ ├── Order.cs
│ │ │ │ │ ├── OrderDetail.cs
│ │ │ │ │ └── Product.cs
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.Northwind.Dao.2008.csproj
│ │ │ │ ├── Spring.Northwind.Dao.2010.csproj
│ │ │ │ └── Spring.Northwind.Dao.csproj
│ │ │ ├── Spring.Northwind.Dao.NHibernate
│ │ │ │ ├── Dao
│ │ │ │ │ ├── Dao.xml
│ │ │ │ │ └── NHibernate
│ │ │ │ │ ├── CustomLocalSessionFactoryObject.cs
│ │ │ │ │ ├── HibernateCustomerDao.cs
│ │ │ │ │ ├── HibernateDao.cs
│ │ │ │ │ ├── HibernateOrderDao.cs
│ │ │ │ │ └── HibernateProductDao.cs
│ │ │ │ ├── Mappings
│ │ │ │ │ ├── Customer.hbm.xml
│ │ │ │ │ ├── Oracle
│ │ │ │ │ │ └── Customer.hbm.xml
│ │ │ │ │ ├── OrderDetail.hbm.xml
│ │ │ │ │ └── Order.hbm.xml
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.Northwind.Dao.NHibernate.2008.csproj
│ │ │ │ ├── Spring.Northwind.Dao.NHibernate.2010.csproj
│ │ │ │ └── Spring.Northwind.Dao.NHibernate.csproj
│ │ │ ├── Spring.Northwind.Service
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Service
│ │ │ │ │ ├── FedExShippingService.cs
│ │ │ │ │ ├── FulfillmentService.cs
│ │ │ │ │ ├── IFulfillmentService.cs
│ │ │ │ │ ├── IShippingService.cs
│ │ │ │ │ └── Services.xml
│ │ │ │ ├── Spring.Northwind.Service.2008.csproj
│ │ │ │ ├── Spring.Northwind.Service.2010.csproj
│ │ │ │ └── Spring.Northwind.Service.csproj
│ │ │ ├── Spring.Northwind.Web
│ │ │ │ ├── App_Code
│ │ │ │ │ ├── ICustomerEditController.cs
│ │ │ │ │ └── NHibernateCustomerEditController.cs
│ │ │ │ ├── App_Data
│ │ │ │ │ └── Northwind.db
│ │ │ │ ├── App_Themes
│ │ │ │ │ └── Spring
│ │ │ │ │ └── Spring.skin
│ │ │ │ ├── Config
│ │ │ │ │ ├── Aspects.xml
│ │ │ │ │ └── Log4Net.xml
│ │ │ │ ├── CSS
│ │ │ │ │ └── style.css
│ │ │ │ ├── CustomerEditor.aspx
│ │ │ │ ├── CustomerEditor.aspx.cs
│ │ │ │ ├── CustomerList.aspx
│ │ │ │ ├── CustomerList.aspx.cs
│ │ │ │ ├── CustomerOrders.aspx
│ │ │ │ ├── CustomerOrders.aspx.cs
│ │ │ │ ├── CustomerView.aspx
│ │ │ │ ├── CustomerView.aspx.cs
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ ├── FulfillmentResult.aspx
│ │ │ │ ├── FulfillmentResult.aspx.cs
│ │ │ │ ├── Global.asax
│ │ │ │ ├── Img
│ │ │ │ │ ├── bg-spring.png
│ │ │ │ │ ├── footern.gif
│ │ │ │ │ ├── header-spring.png
│ │ │ │ │ ├── logo.png
│ │ │ │ │ └── springNet_release.png
│ │ │ │ ├── Shared
│ │ │ │ │ ├── MasterPage.master
│ │ │ │ │ └── MasterPage.master.cs
│ │ │ │ ├── Web.config
│ │ │ │ └── Web.xml
│ │ │ └── Spring.Northwind.Web.References
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.Northwind.Web.References.2008.csproj
│ │ │ ├── Spring.Northwind.Web.References.2010.csproj
│ │ │ ├── Spring.Northwind.Web.References.csproj
│ │ │ └── Spring.Northwind.Web.References.Debug.csproj
│ │ ├── test
│ │ │ └── Spring.Northwind.IntegrationTests
│ │ │ ├── App.config
│ │ │ ├── IntegrationTests
│ │ │ │ ├── AbstractDaoIntegrationTests.cs
│ │ │ │ ├── FulfillmentServiceTests.cs
│ │ │ │ └── NorthwindIntegrationTests.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.Northwind.IntegrationTests.2008.csproj
│ │ │ ├── Spring.Northwind.IntegrationTests.2010.csproj
│ │ │ └── Spring.Northwind.IntegrationTests.csproj
│ │ └── test_northwind.sql
│ ├── Spring.DataQuickStart
│ │ ├── Spring.DataQuickStart.2003.sln
│ │ ├── Spring.DataQuickStart.2005.sln
│ │ ├── Spring.DataQuickStart.2008.sln
│ │ ├── Spring.DataQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── CommonAssemblyInfo.cs
│ │ │ └── Spring.DataQuickStart
│ │ │ ├── DataQuickStart
│ │ │ │ ├── Dao
│ │ │ │ │ ├── GenericTemplate
│ │ │ │ │ │ ├── CommandCallbackDao.cs
│ │ │ │ │ │ ├── CustomerRowMapper.cs
│ │ │ │ │ │ ├── CustOrdersDetailStoredProc.cs
│ │ │ │ │ │ ├── OrderDetailRowMapper.cs
│ │ │ │ │ │ ├── QueryForObjectDao.cs
│ │ │ │ │ │ ├── ResultSetExtractorDao.cs
│ │ │ │ │ │ ├── RowCallbackDao.cs
│ │ │ │ │ │ └── RowMapperDao.cs
│ │ │ │ │ └── Template
│ │ │ │ │ ├── CommandCallbackDao.cs
│ │ │ │ │ ├── CustomerDataSetDao.cs
│ │ │ │ │ ├── CustomerRowMapper.cs
│ │ │ │ │ ├── CustOrdersDetailStoredProc.cs
│ │ │ │ │ ├── OrderDetailRowMapper.cs
│ │ │ │ │ ├── QueryForObjectDao.cs
│ │ │ │ │ ├── ResultSetExtractorDao.cs
│ │ │ │ │ ├── RowCallbackDao.cs
│ │ │ │ │ └── RowMapperDao.cs
│ │ │ │ └── Domain
│ │ │ │ ├── Customer.cs
│ │ │ │ └── OrderDetails.cs
│ │ │ ├── Spring.DataQuickStart.2003.csproj
│ │ │ ├── Spring.DataQuickStart.2005.csproj
│ │ │ ├── Spring.DataQuickStart.2008.csproj
│ │ │ └── Spring.DataQuickStart.2010.csproj
│ │ └── test
│ │ └── Spring
│ │ └── Spring.DataQuickStart.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── DataQuickStart
│ │ │ ├── GenericTemplate
│ │ │ │ ├── ExampleTests.cs
│ │ │ │ └── ExampleTests.xml
│ │ │ └── Template
│ │ │ ├── ExampleTests.cs
│ │ │ └── ExampleTests.xml
│ │ ├── Spring.DataQuickStart.Tests.2003.csproj
│ │ ├── Spring.DataQuickStart.Tests.2005.csproj
│ │ ├── Spring.DataQuickStart.Tests.2008.csproj
│ │ ├── Spring.DataQuickStart.Tests.2010.csproj
│ │ └── Spring.DataQuickStart.Tests.dll.config
│ ├── Spring.EmsQuickStart
│ │ ├── Spring.EmsQuickStart.2008.sln
│ │ ├── Spring.EmsQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── Spring.EmsQuickStart.Client
│ │ │ │ ├── App.config
│ │ │ │ ├── Config
│ │ │ │ │ ├── Application.xml
│ │ │ │ │ └── Messaging.xml
│ │ │ │ ├── Gateways
│ │ │ │ │ ├── EmsStockServiceGateway.cs
│ │ │ │ │ ├── EmsSyncStockServiceGateway.cs
│ │ │ │ │ ├── IStockService.cs
│ │ │ │ │ ├── ISyncStockService.cs
│ │ │ │ │ └── RequestReplyEmsTemplate.cs
│ │ │ │ ├── Handlers
│ │ │ │ │ └── StockAppHandler.cs
│ │ │ │ ├── Program.cs
│ │ │ │ ├── Properties
│ │ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ │ ├── Resources.Designer.cs
│ │ │ │ │ ├── Resources.resx
│ │ │ │ │ ├── Settings.Designer.cs
│ │ │ │ │ └── Settings.settings
│ │ │ │ ├── Spring.EmsQuickStart.Client.2010.csproj
│ │ │ │ ├── Spring.EmsQuickStart.Client.csproj
│ │ │ │ └── UI
│ │ │ │ ├── StockController.cs
│ │ │ │ ├── StockForm.cs
│ │ │ │ ├── StockForm.designer.cs
│ │ │ │ └── StockForm.resx
│ │ │ ├── Spring.EmsQuickStart.Common
│ │ │ │ ├── Bo
│ │ │ │ │ ├── Trade.cs
│ │ │ │ │ └── TradeRequest.cs
│ │ │ │ ├── Converters
│ │ │ │ │ ├── AbstractNamedMessageConverter.cs
│ │ │ │ │ ├── INamedMessageConverter.cs
│ │ │ │ │ ├── ITypeMapper.cs
│ │ │ │ │ ├── MultiMessageConverter.cs
│ │ │ │ │ ├── TradeConverter.cs
│ │ │ │ │ ├── TradeRequestConverter.cs
│ │ │ │ │ ├── TypeMapper.cs
│ │ │ │ │ └── XmlMessageConverter.cs
│ │ │ │ ├── Data
│ │ │ │ │ ├── generate-classes.bat
│ │ │ │ │ ├── TradeRequest.cs
│ │ │ │ │ ├── TradeRequest.xsd
│ │ │ │ │ ├── TradeRequest.xsx
│ │ │ │ │ ├── TradeResponse.cs
│ │ │ │ │ ├── TradeResponse.xsd
│ │ │ │ │ └── TradeResponse.xsx
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.EmsQuickStart.Common.2010.csproj
│ │ │ │ └── Spring.EmsQuickStart.Common.csproj
│ │ │ └── Spring.EmsQuickStart.Server
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── Handlers.xml
│ │ │ │ ├── Messaging.xml
│ │ │ │ └── ServiceStubs.xml
│ │ │ ├── Gateways
│ │ │ │ ├── IMarketDataService.cs
│ │ │ │ └── MarketDataServiceGateway.cs
│ │ │ ├── Handlers
│ │ │ │ ├── LoggingExceptionListener.cs
│ │ │ │ └── StockAppHandler.cs
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Services
│ │ │ │ ├── ICreditCheckService.cs
│ │ │ │ ├── IExecutionVenueService.cs
│ │ │ │ ├── ITradingService.cs
│ │ │ │ └── Stubs
│ │ │ │ ├── CreditCheckServiceStub.cs
│ │ │ │ ├── ExecutionVenueServiceStub.cs
│ │ │ │ └── TradingServiceStub.cs
│ │ │ ├── Spring.EmsQuickStart.Server.2010.csproj
│ │ │ └── Spring.EmsQuickStart.Server.csproj
│ │ └── test
│ │ └── Spring
│ │ ├── Spring.EmsQuickStart.Integration.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Spring.EmsQuickStart.Integration.Tests.2008.csproj
│ │ │ └── Spring.EmsQuickStart.Integration.Tests.2010.csproj
│ │ └── Spring.EmsQuickStart.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.EmsQuickStart.Tests.2008.csproj
│ │ └── Spring.EmsQuickStart.Tests.2010.csproj
│ ├── Spring.Examples.build
│ ├── Spring.IoCQuickStart.AppContext
│ │ ├── Spring.IocQuickStart.AppContext.2003.sln
│ │ ├── Spring.IocQuickStart.AppContext.2005.sln
│ │ ├── Spring.IocQuickStart.AppContext.2008.sln
│ │ ├── Spring.IocQuickStart.AppContext.2010.sln
│ │ ├── Spring.IocQuickStart.AppContext.build
│ │ └── src
│ │ ├── App.config
│ │ ├── AppContext
│ │ │ ├── Images.resx
│ │ │ ├── Keys.cs
│ │ │ ├── MyResource.es.resx
│ │ │ ├── MyResource.resx
│ │ │ ├── Person.cs
│ │ │ ├── Person.resx
│ │ │ ├── Program.cs
│ │ │ ├── ResourcesDisplayForm.cs
│ │ │ └── ResourcesDisplayForm.resx
│ │ ├── Spring.IocQuickStart.AppContext.2003.csproj
│ │ ├── Spring.IocQuickStart.AppContext.2005.csproj
│ │ ├── Spring.IocQuickStart.AppContext.2008.csproj
│ │ └── Spring.IocQuickStart.AppContext.2010.csproj
│ ├── Spring.IoCQuickStart.EventRegistry
│ │ ├── Spring.IocQuickStart.EventRegistry.2003.sln
│ │ ├── Spring.IocQuickStart.EventRegistry.2005.sln
│ │ ├── Spring.IocQuickStart.EventRegistry.2008.sln
│ │ ├── Spring.IocQuickStart.EventRegistry.2010.sln
│ │ ├── Spring.IocQuickStart.EventRegistry.build
│ │ └── src
│ │ ├── App.config
│ │ ├── EventRegistry
│ │ │ ├── MyClientEventArgs.cs
│ │ │ ├── MyEventPublisher.cs
│ │ │ ├── MyEventSubscriber.cs
│ │ │ └── Program.cs
│ │ ├── Spring.IocQuickStart.EventRegistry.2003.csproj
│ │ ├── Spring.IocQuickStart.EventRegistry.2005.csproj
│ │ ├── Spring.IocQuickStart.EventRegistry.2008.csproj
│ │ └── Spring.IocQuickStart.EventRegistry.2010.csproj
│ ├── Spring.IoCQuickStart.MovieFinder
│ │ ├── lib
│ │ │ └── net
│ │ │ ├── 1.0
│ │ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ │ └── log4net.dll
│ │ │ ├── 1.1
│ │ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ │ └── log4net.dll
│ │ │ └── 2.0
│ │ │ ├── Common.Logging.Log4Net.dll
│ │ │ └── log4net.dll
│ │ ├── Spring.IocQuickStart.MovieFinder.2003.sln
│ │ ├── Spring.IocQuickStart.MovieFinder.2005.sln
│ │ ├── Spring.IocQuickStart.MovieFinder.2008.sln
│ │ ├── Spring.IocQuickStart.MovieFinder.2010.sln
│ │ ├── Spring.IocQuickStart.MovieFinder.build
│ │ └── src
│ │ ├── App.config
│ │ ├── MovieFinder
│ │ │ ├── AppContextContribution.xml
│ │ │ ├── AppContext.xml
│ │ │ ├── ColonDelimitedMovieFinder.cs
│ │ │ ├── IMovieFinder.cs
│ │ │ ├── Movie.cs
│ │ │ ├── MovieLister.cs
│ │ │ ├── movies.txt
│ │ │ ├── Program.cs
│ │ │ └── SimpleMovieFinder.cs
│ │ ├── Spring.IocQuickStart.MovieFinder.2003.csproj
│ │ ├── Spring.IocQuickStart.MovieFinder.2005.csproj
│ │ ├── Spring.IocQuickStart.MovieFinder.2008.csproj
│ │ └── Spring.IocQuickStart.MovieFinder.2010.csproj
│ ├── Spring.MsmqQuickStart
│ │ ├── Spring.MsmqQuickStart.2005.sln
│ │ ├── Spring.MsmqQuickStart.2008.sln
│ │ ├── Spring.MsmqQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── Spring.MsmqQuickStart.Client
│ │ │ │ ├── App.config
│ │ │ │ ├── Config
│ │ │ │ │ ├── Application.xml
│ │ │ │ │ └── Messaging.xml
│ │ │ │ ├── Gateways
│ │ │ │ │ ├── IStockService.cs
│ │ │ │ │ └── MsmqStockServiceGateway.cs
│ │ │ │ ├── Handlers
│ │ │ │ │ └── StockAppHandler.cs
│ │ │ │ ├── Program.cs
│ │ │ │ ├── Properties
│ │ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ │ ├── Resources.Designer.cs
│ │ │ │ │ ├── Resources.resx
│ │ │ │ │ ├── Settings.Designer.cs
│ │ │ │ │ └── Settings.settings
│ │ │ │ ├── Spring.MsmqQuickStart.Client.2008.csproj
│ │ │ │ ├── Spring.MsmqQuickStart.Client.2010.csproj
│ │ │ │ ├── Spring.MsmqQuickStart.Client.csproj
│ │ │ │ └── UI
│ │ │ │ ├── StockController.cs
│ │ │ │ ├── StockForm.cs
│ │ │ │ ├── StockForm.designer.cs
│ │ │ │ └── StockForm.resx
│ │ │ ├── Spring.MsmqQuickStart.Common
│ │ │ │ ├── Data
│ │ │ │ │ ├── TradeRequest.cs
│ │ │ │ │ ├── TradeRequest.xsd
│ │ │ │ │ ├── TradeRequest.xsx
│ │ │ │ │ ├── TradeResponse.cs
│ │ │ │ │ ├── TradeResponse.xsd
│ │ │ │ │ └── TradeResponse.xsx
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.MsmqQuickStart.Common.2008.csproj
│ │ │ │ ├── Spring.MsmqQuickStart.Common.2010.csproj
│ │ │ │ └── Spring.MsmqQuickStart.Common.csproj
│ │ │ └── Spring.MsmqQuickStart.Server
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── Handlers.xml
│ │ │ │ ├── Messaging.xml
│ │ │ │ └── ServiceStubs.xml
│ │ │ ├── Gateways
│ │ │ │ ├── IMarketDataService.cs
│ │ │ │ └── MarketDataServiceGateway.cs
│ │ │ ├── Handlers
│ │ │ │ └── StockAppHandler.cs
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Services
│ │ │ │ ├── ICreditCheckService.cs
│ │ │ │ ├── IExecutionVenueService.cs
│ │ │ │ ├── ITradingService.cs
│ │ │ │ └── Stubs
│ │ │ │ ├── CreditCheckServiceStub.cs
│ │ │ │ ├── ExecutionVenueServiceStub.cs
│ │ │ │ └── TradingServiceStub.cs
│ │ │ ├── Spring.MsmqQuickStart.Server.2008.csproj
│ │ │ ├── Spring.MsmqQuickStart.Server.2010.csproj
│ │ │ └── Spring.MsmqQuickStart.Server.csproj
│ │ └── test
│ │ └── Spring
│ │ ├── Spring.MsmqQuickStart.Integration.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Spring.MsmqQuickStart.Integration.Tests.2005.csproj
│ │ │ └── Spring.MsmqQuickStart.Integration.Tests.2010.csproj
│ │ └── Spring.MsmqQuickStart.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.MsmqQuickStart.Tests.2005.csproj
│ │ └── Spring.MsmqQuickStart.Tests.2010.csproj
│ ├── Spring.Mvc3QuickStart
│ │ ├── packages
│ │ │ ├── EntityFramework.4.1.10331.0
│ │ │ │ ├── EntityFramework.4.1.10331.0.nupkg
│ │ │ │ └── lib
│ │ │ │ ├── EntityFramework.dll
│ │ │ │ └── EntityFramework.xml
│ │ │ ├── jQuery.1.5.1
│ │ │ │ ├── Content
│ │ │ │ │ └── Scripts
│ │ │ │ │ ├── jquery-1.5.1.js
│ │ │ │ │ └── jquery-1.5.1.min.js
│ │ │ │ └── jQuery.1.5.1.nupkg
│ │ │ ├── jQuery.UI.Combined.1.8.11
│ │ │ │ ├── Content
│ │ │ │ │ ├── Content
│ │ │ │ │ │ └── themes
│ │ │ │ │ │ └── base
│ │ │ │ │ │ ├── images
│ │ │ │ │ │ │ ├── ui-bg_flat_0_aaaaaa_40x100.png
│ │ │ │ │ │ │ ├── ui-bg_flat_75_ffffff_40x100.png
│ │ │ │ │ │ │ ├── ui-bg_glass_55_fbf9ee_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_glass_65_ffffff_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_glass_75_dadada_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_glass_75_e6e6e6_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_glass_95_fef1ec_1x400.png
│ │ │ │ │ │ │ ├── ui-bg_highlight-soft_75_cccccc_1x100.png
│ │ │ │ │ │ │ ├── ui-icons_222222_256x240.png
│ │ │ │ │ │ │ ├── ui-icons_2e83ff_256x240.png
│ │ │ │ │ │ │ ├── ui-icons_454545_256x240.png
│ │ │ │ │ │ │ ├── ui-icons_888888_256x240.png
│ │ │ │ │ │ │ └── ui-icons_cd0a0a_256x240.png
│ │ │ │ │ │ ├── jquery.ui.accordion.css
│ │ │ │ │ │ ├── jquery.ui.all.css
│ │ │ │ │ │ ├── jquery.ui.autocomplete.css
│ │ │ │ │ │ ├── jquery.ui.base.css
│ │ │ │ │ │ ├── jquery.ui.button.css
│ │ │ │ │ │ ├── jquery.ui.core.css
│ │ │ │ │ │ ├── jquery.ui.datepicker.css
│ │ │ │ │ │ ├── jquery.ui.dialog.css
│ │ │ │ │ │ ├── jquery.ui.progressbar.css
│ │ │ │ │ │ ├── jquery.ui.resizable.css
│ │ │ │ │ │ ├── jquery.ui.selectable.css
│ │ │ │ │ │ ├── jquery.ui.slider.css
│ │ │ │ │ │ ├── jquery.ui.tabs.css
│ │ │ │ │ │ └── jquery.ui.theme.css
│ │ │ │ │ └── Scripts
│ │ │ │ │ ├── jquery-ui-1.8.11.js
│ │ │ │ │ └── jquery-ui-1.8.11.min.js
│ │ │ │ └── jQuery.UI.Combined.1.8.11.nupkg
│ │ │ ├── jQuery.Validation.1.8.0
│ │ │ │ ├── Content
│ │ │ │ │ └── Scripts
│ │ │ │ │ ├── jquery.validate.js
│ │ │ │ │ ├── jquery.validate.min.js
│ │ │ │ │ └── jquery.validate-vsdoc.js
│ │ │ │ └── jQuery.Validation.1.8.0.nupkg
│ │ │ ├── jQuery.vsdoc.1.5.1
│ │ │ │ ├── Content
│ │ │ │ │ └── Scripts
│ │ │ │ │ └── jquery-1.5.1-vsdoc.js
│ │ │ │ └── jQuery.vsdoc.1.5.1.nupkg
│ │ │ ├── Modernizr.1.7
│ │ │ │ ├── Content
│ │ │ │ │ └── Scripts
│ │ │ │ │ ├── modernizr-1.7.js
│ │ │ │ │ └── modernizr-1.7.min.js
│ │ │ │ └── Modernizr.1.7.nupkg
│ │ │ └── repositories.config
│ │ ├── Spring.Mvc3QuickStart.sln
│ │ ├── Spring.Mvc3QuickStart.sln.docstates
│ │ └── src
│ │ └── Spring.Mvc3QuickStart
│ │ ├── App_Data
│ │ ├── Config
│ │ │ └── controllers.xml
│ │ ├── Content
│ │ │ ├── Site.css
│ │ │ └── themes
│ │ │ └── base
│ │ │ ├── images
│ │ │ │ ├── ui-bg_flat_0_aaaaaa_40x100.png
│ │ │ │ ├── ui-bg_flat_75_ffffff_40x100.png
│ │ │ │ ├── ui-bg_glass_55_fbf9ee_1x400.png
│ │ │ │ ├── ui-bg_glass_65_ffffff_1x400.png
│ │ │ │ ├── ui-bg_glass_75_dadada_1x400.png
│ │ │ │ ├── ui-bg_glass_75_e6e6e6_1x400.png
│ │ │ │ ├── ui-bg_glass_95_fef1ec_1x400.png
│ │ │ │ ├── ui-bg_highlight-soft_75_cccccc_1x100.png
│ │ │ │ ├── ui-icons_222222_256x240.png
│ │ │ │ ├── ui-icons_2e83ff_256x240.png
│ │ │ │ ├── ui-icons_454545_256x240.png
│ │ │ │ ├── ui-icons_888888_256x240.png
│ │ │ │ └── ui-icons_cd0a0a_256x240.png
│ │ │ ├── jquery.ui.accordion.css
│ │ │ ├── jquery.ui.all.css
│ │ │ ├── jquery.ui.autocomplete.css
│ │ │ ├── jquery.ui.base.css
│ │ │ ├── jquery.ui.button.css
│ │ │ ├── jquery.ui.core.css
│ │ │ ├── jquery.ui.datepicker.css
│ │ │ ├── jquery.ui.dialog.css
│ │ │ ├── jquery.ui.progressbar.css
│ │ │ ├── jquery.ui.resizable.css
│ │ │ ├── jquery.ui.selectable.css
│ │ │ ├── jquery.ui.slider.css
│ │ │ ├── jquery.ui.tabs.css
│ │ │ └── jquery.ui.theme.css
│ │ ├── Controllers
│ │ │ ├── AccountController.cs
│ │ │ └── HomeController.cs
│ │ ├── Global.asax
│ │ ├── Global.asax.cs
│ │ ├── Models
│ │ │ └── AccountModels.cs
│ │ ├── packages.config
│ │ ├── Properties
│ │ │ └── AssemblyInfo.cs
│ │ ├── Scripts
│ │ │ ├── jquery-1.5.1.js
│ │ │ ├── jquery-1.5.1.min.js
│ │ │ ├── jquery-1.5.1-vsdoc.js
│ │ │ ├── jquery-ui-1.8.11.js
│ │ │ ├── jquery-ui-1.8.11.min.js
│ │ │ ├── jquery.unobtrusive-ajax.js
│ │ │ ├── jquery.unobtrusive-ajax.min.js
│ │ │ ├── jquery.validate.js
│ │ │ ├── jquery.validate.min.js
│ │ │ ├── jquery.validate.unobtrusive.js
│ │ │ ├── jquery.validate.unobtrusive.min.js
│ │ │ ├── jquery.validate-vsdoc.js
│ │ │ ├── MicrosoftAjax.debug.js
│ │ │ ├── MicrosoftAjax.js
│ │ │ ├── MicrosoftMvcAjax.debug.js
│ │ │ ├── MicrosoftMvcAjax.js
│ │ │ ├── MicrosoftMvcValidation.debug.js
│ │ │ ├── MicrosoftMvcValidation.js
│ │ │ ├── modernizr-1.7.js
│ │ │ └── modernizr-1.7.min.js
│ │ ├── Spring.Mvc3QuickStart.csproj
│ │ ├── Views
│ │ │ ├── Account
│ │ │ │ ├── ChangePassword.cshtml
│ │ │ │ ├── ChangePasswordSuccess.cshtml
│ │ │ │ ├── LogOn.cshtml
│ │ │ │ └── Register.cshtml
│ │ │ ├── Home
│ │ │ │ ├── About.cshtml
│ │ │ │ └── Index.cshtml
│ │ │ ├── Shared
│ │ │ │ ├── Error.cshtml
│ │ │ │ ├── _Layout.cshtml
│ │ │ │ └── _LogOnPartial.cshtml
│ │ │ ├── _ViewStart.cshtml
│ │ │ └── Web.config
│ │ ├── Web.config
│ │ ├── Web.Debug.config
│ │ └── Web.Release.config
│ ├── Spring.MvcQuickStart
│ │ ├── Spring.MvcQuickStart.2010.sln
│ │ └── src
│ │ └── Spring.MvcQuickStart
│ │ ├── App_Data
│ │ ├── Config
│ │ │ └── controllers.xml
│ │ ├── Content
│ │ │ └── Site.css
│ │ ├── Controllers
│ │ │ ├── AccountController.cs
│ │ │ └── HomeController.cs
│ │ ├── Global.asax
│ │ ├── Global.asax.cs
│ │ ├── Models
│ │ │ └── AccountModels.cs
│ │ ├── Properties
│ │ │ └── AssemblyInfo.cs
│ │ ├── Scripts
│ │ │ ├── jquery-1.4.1.js
│ │ │ ├── jquery-1.4.1.min.js
│ │ │ ├── jquery-1.4.1-vsdoc.js
│ │ │ ├── jquery.validate.js
│ │ │ ├── jquery.validate.min.js
│ │ │ ├── jquery.validate-vsdoc.js
│ │ │ ├── MicrosoftAjax.debug.js
│ │ │ ├── MicrosoftAjax.js
│ │ │ ├── MicrosoftMvcAjax.debug.js
│ │ │ ├── MicrosoftMvcAjax.js
│ │ │ ├── MicrosoftMvcValidation.debug.js
│ │ │ └── MicrosoftMvcValidation.js
│ │ ├── Spring.MvcQuickStart.2010.csproj
│ │ ├── Views
│ │ │ ├── Account
│ │ │ │ ├── ChangePassword.aspx
│ │ │ │ ├── ChangePasswordSuccess.aspx
│ │ │ │ ├── LogOn.aspx
│ │ │ │ └── Register.aspx
│ │ │ ├── Home
│ │ │ │ ├── About.aspx
│ │ │ │ └── Index.aspx
│ │ │ ├── Shared
│ │ │ │ ├── Error.aspx
│ │ │ │ ├── LogOnUserControl.ascx
│ │ │ │ └── Site.Master
│ │ │ └── Web.config
│ │ ├── Web.config
│ │ ├── Web.Debug.config
│ │ └── Web.Release.config
│ ├── Spring.NmsQuickStart
│ │ ├── Spring.NmsQuickStart.2005.sln
│ │ ├── Spring.NmsQuickStart.2008.sln
│ │ ├── Spring.NmsQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── Spring.NmsQuickStart.Client
│ │ │ │ ├── App.config
│ │ │ │ ├── Config
│ │ │ │ │ ├── Application.xml
│ │ │ │ │ └── Messaging.xml
│ │ │ │ ├── Gateways
│ │ │ │ │ ├── IStockService.cs
│ │ │ │ │ ├── ISyncStockService.cs
│ │ │ │ │ ├── NmsStockServiceGateway.cs
│ │ │ │ │ ├── NmsSyncStockServiceGateway.cs
│ │ │ │ │ └── RequestReplyNmsTemplate.cs
│ │ │ │ ├── Handlers
│ │ │ │ │ └── StockAppHandler.cs
│ │ │ │ ├── Program.cs
│ │ │ │ ├── Properties
│ │ │ │ │ ├── AssemblyInfo.cs
│ │ │ │ │ ├── Resources.Designer.cs
│ │ │ │ │ ├── Resources.resx
│ │ │ │ │ ├── Settings.Designer.cs
│ │ │ │ │ └── Settings.settings
│ │ │ │ ├── Spring.NmsQuickStart.Client.2008.csproj
│ │ │ │ ├── Spring.NmsQuickStart.Client.2010.csproj
│ │ │ │ ├── Spring.NmsQuickStart.Client.csproj
│ │ │ │ └── UI
│ │ │ │ ├── StockController.cs
│ │ │ │ ├── StockForm.cs
│ │ │ │ ├── StockForm.designer.cs
│ │ │ │ └── StockForm.resx
│ │ │ ├── Spring.NmsQuickStart.Common
│ │ │ │ ├── Bo
│ │ │ │ │ ├── Trade.cs
│ │ │ │ │ └── TradeRequest.cs
│ │ │ │ ├── Converters
│ │ │ │ │ ├── AbstractNamedMessageConverter.cs
│ │ │ │ │ ├── INamedMessageConverter.cs
│ │ │ │ │ ├── ITypeMapper.cs
│ │ │ │ │ ├── MultiMessageConverter.cs
│ │ │ │ │ ├── TradeConverter.cs
│ │ │ │ │ ├── TradeRequestConverter.cs
│ │ │ │ │ ├── TypeMapper.cs
│ │ │ │ │ └── XmlMessageConverter.cs
│ │ │ │ ├── Data
│ │ │ │ │ ├── generate-classes.bat
│ │ │ │ │ ├── TradeRequest.cs
│ │ │ │ │ ├── TradeRequest.xsd
│ │ │ │ │ ├── TradeRequest.xsx
│ │ │ │ │ ├── TradeResponse.cs
│ │ │ │ │ ├── TradeResponse.xsd
│ │ │ │ │ └── TradeResponse.xsx
│ │ │ │ ├── Properties
│ │ │ │ │ └── AssemblyInfo.cs
│ │ │ │ ├── Spring.NmsQuickStart.Common.2008.csproj
│ │ │ │ ├── Spring.NmsQuickStart.Common.2010.csproj
│ │ │ │ └── Spring.NmsQuickStart.Common.csproj
│ │ │ └── Spring.NmsQuickStart.Server
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── Handlers.xml
│ │ │ │ ├── Messaging.xml
│ │ │ │ └── ServiceStubs.xml
│ │ │ ├── Gateways
│ │ │ │ ├── IMarketDataService.cs
│ │ │ │ └── MarketDataServiceGateway.cs
│ │ │ ├── Handlers
│ │ │ │ ├── LoggingExceptionListener.cs
│ │ │ │ └── StockAppHandler.cs
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Services
│ │ │ │ ├── ICreditCheckService.cs
│ │ │ │ ├── IExecutionVenueService.cs
│ │ │ │ ├── ITradingService.cs
│ │ │ │ └── Stubs
│ │ │ │ ├── CreditCheckServiceStub.cs
│ │ │ │ ├── ExecutionVenueServiceStub.cs
│ │ │ │ └── TradingServiceStub.cs
│ │ │ ├── Spring.NmsQuickStart.Server.2008.csproj
│ │ │ ├── Spring.NmsQuickStart.Server.2010.csproj
│ │ │ └── Spring.NmsQuickStart.Server.csproj
│ │ └── test
│ │ └── Spring
│ │ ├── Spring.NmsQuickStart.Integration.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Spring.NmsQuickStart.Integration.Tests.2005.csproj
│ │ │ ├── Spring.NmsQuickStart.Integration.Tests.2008.csproj
│ │ │ └── Spring.NmsQuickStart.Integration.Tests.2010.csproj
│ │ └── Spring.NmsQuickStart.Tests
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.NmsQuickStart.Tests.2005.csproj
│ │ ├── Spring.NmsQuickStart.Tests.2008.csproj
│ │ └── Spring.NmsQuickStart.Tests.2010.csproj
│ ├── Spring.Scheduling.Quartz.Example
│ │ ├── Spring.Scheduling.Quartz.Example.2003.sln
│ │ ├── Spring.Scheduling.Quartz.Example.2005.sln
│ │ ├── Spring.Scheduling.Quartz.Example.2008.sln
│ │ ├── Spring.Scheduling.Quartz.Example.2010.sln
│ │ ├── Spring.Scheduling.Quartz.Example.build
│ │ ├── src
│ │ │ ├── AdminService.cs
│ │ │ ├── App.config
│ │ │ ├── ExampleJob.cs
│ │ │ ├── Program.cs
│ │ │ ├── spring-objects.xml
│ │ │ ├── Spring.Scheduling.Quartz.Example.2003.csproj
│ │ │ ├── Spring.Scheduling.Quartz.Example.2005.csproj
│ │ │ ├── Spring.Scheduling.Quartz.Example.2008.csproj
│ │ │ ├── Spring.Scheduling.Quartz.Example.2010.csproj
│ │ │ └── Spring.Scheduling.Quartz.Example.xml
│ │ ├── UpgradeLog.XML
│ │ └── _UpgradeReport_Files
│ │ ├── UpgradeReport.css
│ │ ├── UpgradeReport_Minus.gif
│ │ ├── UpgradeReport_Plus.gif
│ │ └── UpgradeReport.xslt
│ ├── Spring.TxQuickStart
│ │ ├── Spring.TxQuickStart.2003.sln
│ │ ├── Spring.TxQuickStart.2005.sln
│ │ ├── Spring.TxQuickStart.2008.sln
│ │ ├── Spring.TxQuickStart.2010.sln
│ │ ├── src
│ │ │ └── Spring
│ │ │ ├── CommonAssemblyInfo.cs
│ │ │ └── Spring.TxQuickStart
│ │ │ ├── Spring.TxQuickStart.2003.csproj
│ │ │ ├── Spring.TxQuickStart.2005.csproj
│ │ │ ├── Spring.TxQuickStart.2008.csproj
│ │ │ ├── Spring.TxQuickStart.2010.csproj
│ │ │ ├── Spring.TxQuickStart.xml
│ │ │ └── TxQuickStart
│ │ │ ├── application-config.xml
│ │ │ ├── CreditsDebitsSchema.sql
│ │ │ ├── Dao
│ │ │ │ ├── Ado
│ │ │ │ │ ├── AccountCreditDao.cs
│ │ │ │ │ └── AccountDebitDao.cs
│ │ │ │ ├── IAccountCreditDao.cs
│ │ │ │ └── IAccountDebitDao.cs
│ │ │ └── Services
│ │ │ ├── AccountManager.cs
│ │ │ └── IAccountManager.cs
│ │ ├── test
│ │ │ └── Spring
│ │ │ └── Spring.TxQuickStart.Tests
│ │ │ ├── AssemblyInfo.cs
│ │ │ ├── Spring.TxQuickStart.Tests.2003.csproj
│ │ │ ├── Spring.TxQuickStart.Tests.2005.csproj
│ │ │ ├── Spring.TxQuickStart.Tests.2008.csproj
│ │ │ ├── Spring.TxQuickStart.Tests.2010.csproj
│ │ │ ├── Spring.TxQuickStart.Tests.build
│ │ │ ├── Spring.TxQuickStart.Tests.dll.config
│ │ │ └── TxQuickStart
│ │ │ ├── AccountManagerTests.cs
│ │ │ ├── aspects-config.xml
│ │ │ ├── Services
│ │ │ │ ├── AccountManagerUnitTests.cs
│ │ │ │ ├── StubAccountCreditDao.cs
│ │ │ │ └── StubAccountDebitDao.cs
│ │ │ ├── system-test-dtc-config.xml
│ │ │ ├── system-test-dtc-es-config.xml
│ │ │ └── system-test-local-config.xml
│ │ ├── UpgradeLog.XML
│ │ └── _UpgradeReport_Files
│ │ ├── UpgradeReport.css
│ │ ├── UpgradeReport_Minus.gif
│ │ ├── UpgradeReport_Plus.gif
│ │ └── UpgradeReport.xslt
│ ├── Spring.WcfQuickStart
│ │ ├── Spring.WcfQuickStart.2008.sln
│ │ ├── Spring.WcfQuickStart.2010.sln
│ │ └── src
│ │ ├── Spring.WcfQuickStart.Aspects
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── SimplePerformanceInterceptor.cs
│ │ │ ├── Spring.WcfQuickStart.Aspects.2010.csproj
│ │ │ └── Spring.WcfQuickStart.Aspects.csproj
│ │ ├── Spring.WcfQuickStart.ClientApp
│ │ │ ├── App.config
│ │ │ ├── Config
│ │ │ │ ├── Aspects.xml
│ │ │ │ ├── ServerApp.xml
│ │ │ │ └── ServerWeb.xml
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.WcfQuickStart.ClientApp.2008.csproj
│ │ │ └── Spring.WcfQuickStart.ClientApp.2010.csproj
│ │ ├── Spring.WcfQuickStart.Contracts
│ │ │ ├── AbstractCalculatorService.cs
│ │ │ ├── ICalculator.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.WcfQuickStart.Contracts.2010.csproj
│ │ │ └── Spring.WcfQuickStart.Contracts.csproj
│ │ ├── Spring.WcfQuickStart.ServerApp
│ │ │ ├── App.config
│ │ │ ├── CalculatorService.cs
│ │ │ ├── Program.cs
│ │ │ ├── Properties
│ │ │ │ └── AssemblyInfo.cs
│ │ │ ├── Spring.WcfQuickStart.ServerApp.2008.csproj
│ │ │ └── Spring.WcfQuickStart.ServerApp.2010.csproj
│ │ └── Spring.WcfQuickStart.ServerWeb
│ │ ├── CalculatorService.cs
│ │ ├── Calculator.svc
│ │ ├── Properties
│ │ │ └── AssemblyInfo.cs
│ │ ├── Spring.WcfQuickStart.ServerWeb.2008.csproj
│ │ ├── Spring.WcfQuickStart.ServerWeb.2010.csproj
│ │ └── Web.config
│ ├── Spring.Web.Extensions.Example
│ │ ├── Spring.Web.Extensions.Example.2005.sln
│ │ ├── Spring.Web.Extensions.Example.2008.sln
│ │ ├── Spring.Web.Extensions.Example.2010.sln
│ │ └── src
│ │ ├── Spring.Web.Extensions.Example.2005
│ │ │ ├── App_Code
│ │ │ │ ├── ContactService.cs
│ │ │ │ ├── IContactService.cs
│ │ │ │ └── StringArrayFilterAdvice.cs
│ │ │ ├── Bin
│ │ │ │ ├── Common.Logging.dll.refresh
│ │ │ │ ├── Spring.Aop.dll.refresh
│ │ │ │ ├── Spring.Core.dll.refresh
│ │ │ │ ├── Spring.Web.dll.refresh
│ │ │ │ ├── Spring.Web.Extensions.dll.refresh
│ │ │ │ └── System.Web.Extensions.dll.refresh
│ │ │ ├── ContactWebServiceMethods.js
│ │ │ ├── Default.aspx
│ │ │ ├── Spring.config
│ │ │ └── Web.config
│ │ ├── Spring.Web.Extensions.Example.2008
│ │ │ ├── App_Code
│ │ │ │ ├── ContactService.cs
│ │ │ │ ├── IContactService.cs
│ │ │ │ └── StringArrayFilterAdvice.cs
│ │ │ ├── Bin
│ │ │ │ ├── Common.Logging.dll.refresh
│ │ │ │ ├── Spring.Aop.dll.refresh
│ │ │ │ ├── Spring.Core.dll.refresh
│ │ │ │ ├── Spring.Web.dll.refresh
│ │ │ │ └── Spring.Web.Extensions.dll.refresh
│ │ │ ├── ContactWebServiceMethods.js
│ │ │ ├── Default.aspx
│ │ │ ├── Spring.config
│ │ │ └── Web.config
│ │ └── Spring.Web.Extensions.Example.2010
│ │ ├── App_Code
│ │ │ ├── ContactService.cs
│ │ │ ├── IContactService.cs
│ │ │ └── StringArrayFilterAdvice.cs
│ │ ├── Bin
│ │ │ ├── Common.Logging.dll.refresh
│ │ │ ├── Spring.Aop.dll.refresh
│ │ │ ├── Spring.Core.dll.refresh
│ │ │ ├── Spring.Web.dll.refresh
│ │ │ └── Spring.Web.Extensions.dll.refresh
│ │ ├── ContactWebServiceMethods.js
│ │ ├── Default.aspx
│ │ ├── Spring.config
│ │ └── Web.config
│ └── Spring.WebQuickStart
│ ├── Spring.WebQuickStart.2005.sln
│ ├── Spring.WebQuickStart.2008.sln
│ ├── Spring.WebQuickStart.2010.sln
│ ├── src
│ │ ├── Spring.WebQuickStart.2005
│ │ │ ├── App_Code
│ │ │ │ ├── EmployeeInfo.cs
│ │ │ │ ├── HtmlCommentAppenderModule.cs
│ │ │ │ ├── MyCustomHttpHandler.cs
│ │ │ │ └── ProductInfo.cs
│ │ │ ├── DataBinding
│ │ │ │ ├── Collections
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ ├── EasyEmployeeInfo
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.cs
│ │ │ │ │ └── Web.Config
│ │ │ │ ├── EmployeeInfo
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── EventHandling
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── HelloWorld
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── Lists
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ └── Default.aspx.cs
│ │ │ │ ├── NestedEmployeeInfo
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.cs
│ │ │ │ │ ├── EmployeeInfoEditor.ascx
│ │ │ │ │ └── EmployeeInfoEditor.ascx.cs
│ │ │ │ └── RobustEmployeeInfo
│ │ │ │ ├── Default.aspx
│ │ │ │ └── Default.aspx.cs
│ │ │ ├── Default.aspx
│ │ │ ├── Default.aspx.cs
│ │ │ ├── DI
│ │ │ │ ├── CustomHandlers
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.bak
│ │ │ │ │ ├── DemoHandler.ashx
│ │ │ │ │ └── web.config
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ ├── HelloWorld
│ │ │ │ │ ├── CustomControl.ascx
│ │ │ │ │ ├── CustomControl.ascx.cs
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.cs
│ │ │ │ │ ├── Splashpage.aspx
│ │ │ │ │ └── Web.config
│ │ │ │ └── NestedContexts
│ │ │ │ ├── ContextA
│ │ │ │ │ ├── CustomControl.ascx
│ │ │ │ │ └── CustomControl.ascx.cs
│ │ │ │ ├── ContextB
│ │ │ │ │ ├── CustomControl.ascx
│ │ │ │ │ ├── CustomControl.ascx.cs
│ │ │ │ │ ├── Default.aspx
│ │ │ │ │ ├── Default.aspx.cs
│ │ │ │ │ └── Web.config
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ └── Web.config
│ │ │ ├── Navigation
│ │ │ │ ├── Default.aspx
│ │ │ │ ├── Default.aspx.cs
│ │ │ │ ├── InvalidInput.aspx
│ │ │ │ ├── InvalidInput.aspx.cs
│ │ │ │ ├── Master.master
│ │ │ │ ├── Master.master.cs
│ │ │ │ ├── Ok.aspx
│ │ │ │ ├── Ok.aspx.cs
│ │ │ │ └── Web.config
│ │ │ ├── Web.Config
│ │ │ └── web_mediumtrust.config
│ │ └── Spring.WebQuickStart.Providers
│ │ ├── App_Code
│ │ │ └── TextFileWebEventProvider.cs
│ │ ├── App_Data
│ │ │ ├── aspnetdb_log.ldf
│ │ │ └── ASPNETDB.MDF
│ │ ├── Config
│ │ │ └── Web.xml
│ │ ├── Default.aspx
│ │ ├── Default.aspx.cs
│ │ ├── Global.asax
│ │ ├── SitemapTest.aspx
│ │ ├── SitemapTest.aspx.cs
│ │ ├── TestProviders
│ │ │ ├── MembershipTest.aspx
│ │ │ ├── MembershipTest.aspx.cs
│ │ │ ├── ProfileTest.aspx
│ │ │ ├── ProfileTest.aspx.cs
│ │ │ ├── RolesTest.aspx
│ │ │ ├── RolesTest.aspx.cs
│ │ │ └── Web.config
│ │ ├── UserLogin.aspx
│ │ ├── UserLogin.aspx.cs
│ │ ├── Web.config
│ │ └── Web.sitemap
│ ├── test
│ └── test.integration
├── lib
│ ├── Net
│ │ ├── 1.0
│ │ │ ├── Common.Logging.dll
│ │ │ ├── DotNetMock.dll
│ │ │ ├── DotNetMock.Framework.dll
│ │ │ ├── nunit.framework.dll
│ │ │ └── Rhino.Mocks.dll
│ │ ├── 1.1
│ │ │ ├── Common.Logging.dll
│ │ │ ├── DotNetMock.dll
│ │ │ ├── DotNetMock.Framework.dll
│ │ │ ├── Nullables.dll
│ │ │ ├── NUnitAsp.dll
│ │ │ ├── NUnitAspEx.dll
│ │ │ ├── nunit.core.dll
│ │ │ ├── nunit.core.interfaces.dll
│ │ │ ├── nunit.framework.dll
│ │ │ ├── nunit.framework.xml
│ │ │ ├── Quartz.dll
│ │ │ └── Rhino.Mocks.dll
│ │ ├── 2.0
│ │ │ ├── Apache.NMS.ActiveMQ.dll
│ │ │ ├── Apache.NMS.ActiveMQ.pdb
│ │ │ ├── Apache.NMS.dll
│ │ │ ├── Apache.NMS.pdb
│ │ │ ├── Common.Logging.dll
│ │ │ ├── DotNetMock.dll
│ │ │ ├── DotNetMock.Framework.dll
│ │ │ ├── EULA.rtf
│ │ │ ├── NUnitAsp.dll
│ │ │ ├── NUnitAspEx.dll
│ │ │ ├── nunit.core.dll
│ │ │ ├── nunit.core.interfaces.dll
│ │ │ ├── nunit.framework.dll
│ │ │ ├── nunit.framework.xml
│ │ │ ├── NVelocity.dll
│ │ │ ├── NVelocity.pdb
│ │ │ ├── Quartz.dll
│ │ │ └── Rhino.Mocks.dll
│ │ ├── 3.5
│ │ │ ├── Apache.NMS.ActiveMQ.dll
│ │ │ ├── Apache.NMS.dll
│ │ │ ├── Common.Logging.dll
│ │ │ ├── DotNetMock.dll
│ │ │ ├── DotNetMock.Framework.dll
│ │ │ ├── NUnitAsp.dll
│ │ │ ├── NUnitAspEx.dll
│ │ │ ├── nunit.core.dll
│ │ │ ├── nunit.core.interfaces.dll
│ │ │ ├── nunit.framework.dll
│ │ │ ├── nunit.framework.xml
│ │ │ ├── NVelocity.dll
│ │ │ ├── Quartz.dll
│ │ │ └── Rhino.Mocks.dll
│ │ └── 4.0
│ │ ├── Apache.NMS.ActiveMQ.dll
│ │ ├── Apache.NMS.dll
│ │ ├── Common.Logging.dll
│ │ ├── DotNetMock.dll
│ │ ├── DotNetMock.Framework.dll
│ │ ├── NUnitAsp.dll
│ │ ├── NUnitAspEx.dll
│ │ ├── nunit.core.dll
│ │ ├── nunit.core.interfaces.dll
│ │ ├── nunit.framework.dll
│ │ ├── nunit.framework.xml
│ │ ├── NVelocity.dll
│ │ ├── Quartz.dll
│ │ └── Rhino.Mocks.dll
│ ├── NHibernate12
│ │ └── net
│ │ ├── 1.1
│ │ │ ├── Castle.DynamicProxy.dll
│ │ │ ├── Castle.DynamicProxy.xml
│ │ │ ├── HashCodeProvider.dll
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.xml
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.xml
│ │ │ ├── NHibernate.dll
│ │ │ └── NHibernate.xml
│ │ ├── 2.0
│ │ │ ├── Castle.DynamicProxy.dll
│ │ │ ├── Castle.DynamicProxy.license.txt
│ │ │ ├── Castle.DynamicProxy.xml
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── Iesi.Collections.xml
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.xml
│ │ │ ├── NHibernate.dll
│ │ │ ├── NHibernate.license.txt
│ │ │ └── NHibernate.xml
│ │ └── 4.0
│ │ ├── Castle.DynamicProxy.dll
│ │ ├── Castle.DynamicProxy.license.txt
│ │ ├── Castle.DynamicProxy.xml
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── Iesi.Collections.xml
│ │ ├── log4net.dll
│ │ ├── log4net.xml
│ │ ├── NHibernate.dll
│ │ ├── NHibernate.license.txt
│ │ └── NHibernate.xml
│ ├── NHibernate20
│ │ └── net
│ │ ├── 2.0
│ │ │ ├── Castle.Core.dll
│ │ │ ├── Castle.Core.xml
│ │ │ ├── Castle.DynamicProxy2.dll
│ │ │ ├── Castle.DynamicProxy2.xml
│ │ │ ├── Castle.DynamicProxy.license.txt
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── Iesi.Collections.xml
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.license.txt
│ │ │ ├── log4net.xml
│ │ │ ├── NHibernate.dll
│ │ │ ├── NHibernate.license.txt
│ │ │ └── NHibernate.xml
│ │ └── 4.0
│ │ ├── Castle.Core.dll
│ │ ├── Castle.Core.xml
│ │ ├── Castle.DynamicProxy2.dll
│ │ ├── Castle.DynamicProxy2.xml
│ │ ├── Castle.DynamicProxy.license.txt
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── Iesi.Collections.xml
│ │ ├── log4net.dll
│ │ ├── log4net.license.txt
│ │ ├── log4net.xml
│ │ ├── NHibernate.dll
│ │ ├── NHibernate.license.txt
│ │ └── NHibernate.xml
│ ├── NHibernate21
│ │ └── net
│ │ ├── 2.0
│ │ │ ├── Antlr3.Runtime.dll
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── Iesi.Collections.xml
│ │ │ ├── LinFu.DynamicProxy.dll
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.license.txt
│ │ │ ├── log4net.xml
│ │ │ ├── NHibernate.dll
│ │ │ ├── NHibernate.DomainModel.dll
│ │ │ ├── NHibernate.license.txt
│ │ │ ├── NHibernate.Test.dll
│ │ │ └── NHibernate.xml
│ │ └── 4.0
│ │ ├── Antlr3.Runtime.dll
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── Iesi.Collections.xml
│ │ ├── LinFu.DynamicProxy.dll
│ │ ├── log4net.dll
│ │ ├── log4net.license.txt
│ │ ├── log4net.xml
│ │ ├── NHibernate.dll
│ │ ├── NHibernate.DomainModel.dll
│ │ ├── NHibernate.license.txt
│ │ ├── NHibernate.Test.dll
│ │ └── NHibernate.xml
│ ├── NHibernate30
│ │ └── net
│ │ ├── 3.5
│ │ │ ├── Antlr3.Runtime.dll
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── log4net.dll
│ │ │ ├── log4net.license.txt
│ │ │ ├── NHibernate.dll
│ │ │ ├── NHibernate.license.txt
│ │ │ └── Remotion.Data.Linq.dll
│ │ └── 4.0
│ │ ├── Antlr3.Runtime.dll
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── log4net.dll
│ │ ├── log4net.license.txt
│ │ ├── NHibernate.dll
│ │ ├── NHibernate.license.txt
│ │ └── Remotion.Data.Linq.dll
│ ├── NHibernate31
│ │ └── net
│ │ ├── 3.5
│ │ │ ├── Iesi.Collections.dll
│ │ │ ├── Iesi.Collections.license.txt
│ │ │ ├── NHibernate.dll
│ │ │ └── NHibernate.license.txt
│ │ └── 4.0
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── NHibernate.dll
│ │ └── NHibernate.license.txt
│ └── NHibernate32
│ └── net
│ ├── 3.5
│ │ ├── Iesi.Collections.dll
│ │ ├── Iesi.Collections.license.txt
│ │ ├── NHibernate.dll
│ │ └── NHibernate.license.txt
│ └── 4.0
│ ├── Iesi.Collections.dll
│ ├── Iesi.Collections.license.txt
│ ├── NHibernate.dll
│ └── NHibernate.license.txt
├── license.txt
├── readme.txt
├── Spring.build
├── Spring.include
├── Spring.Net.2003.sln
├── Spring.Net.2005.sln
├── Spring.Net.2008.sln
├── Spring.Net.2010.sln
├── src
│ └── Spring
│ ├── CommonAssemblyInfo.cs
│ ├── Spring.Aop
│ │ ├── Aop
│ │ │ ├── Config
│ │ │ │ ├── AopNamespaceParser.cs
│ │ │ │ ├── AopNamespaceUtils.cs
│ │ │ │ ├── ConfigObjectDefinitionParser.cs
│ │ │ │ ├── spring-aop-1.1.xsd
│ │ │ │ └── spring-aop-1.1.xsx
│ │ │ ├── Framework
│ │ │ │ ├── AbstractMethodInvocation.cs
│ │ │ │ ├── Adapter
│ │ │ │ │ ├── AdvisorAdapterRegistrationManager.cs
│ │ │ │ │ ├── AfterReturningAdviceAdapter.cs
│ │ │ │ │ ├── AfterReturningAdviceInterceptor.cs
│ │ │ │ │ ├── BeforeAdviceAdapter.cs
│ │ │ │ │ ├── DefaultAdvisorAdapterRegistry.cs
│ │ │ │ │ ├── GlobalAdvisorAdapterRegistry.cs
│ │ │ │ │ ├── IAdvisorAdapter.cs
│ │ │ │ │ ├── IAdvisorAdapterRegistry.cs
│ │ │ │ │ ├── MethodBeforeAdviceInterceptor.cs
│ │ │ │ │ ├── ThrowsAdviceAdapter.cs
│ │ │ │ │ ├── ThrowsAdviceInterceptor.cs
│ │ │ │ │ └── UnknownAdviceTypeException.cs
│ │ │ │ ├── AdvisedSupport.cs
│ │ │ │ ├── AdvisorChainFactoryUtils.cs
│ │ │ │ ├── AopConfigException.cs
│ │ │ │ ├── AopContext.cs
│ │ │ │ ├── AopUtils.cs
│ │ │ │ ├── AutoProxy
│ │ │ │ │ ├── AbstractAdvisorAutoProxyCreator.cs
│ │ │ │ │ ├── AbstractAutoProxyCreator.cs
│ │ │ │ │ ├── AbstractFilteringAutoProxyCreator.cs
│ │ │ │ │ ├── AttributeAutoProxyCreator.cs
│ │ │ │ │ ├── DefaultAdvisorAutoProxyCreator.cs
│ │ │ │ │ ├── IAdvisorRetrievalHelper.cs
│ │ │ │ │ ├── InfrastructureAdvisorAutoProxyCreator.cs
│ │ │ │ │ ├── InheritanceBasedAopConfigurer.cs
│ │ │ │ │ ├── ITargetSourceCreator.cs
│ │ │ │ │ ├── ObjectFactoryAdvisorRetrievalHelper.cs
│ │ │ │ │ ├── ObjectNameAutoProxyCreator.cs
│ │ │ │ │ ├── PointcutFilteringAutoProxyCreator.cs
│ │ │ │ │ ├── Target
│ │ │ │ │ │ └── AbstractPrototypeTargetSourceCreator.cs
│ │ │ │ │ └── TypeNameAutoProxyCreator.cs
│ │ │ │ ├── DynamicMethodInvocation.cs
│ │ │ │ ├── DynamicProxy
│ │ │ │ │ ├── AbstractAopProxyFactory.cs
│ │ │ │ │ ├── AbstractAopProxyMethodBuilder.cs
│ │ │ │ │ ├── AbstractAopProxyTypeBuilder.cs
│ │ │ │ │ ├── AdvisedProxy.cs
│ │ │ │ │ ├── BaseAopProxyMethodBuilder.cs
│ │ │ │ │ ├── BaseCompositionAopProxy.cs
│ │ │ │ │ ├── CachedAopProxyFactory.cs
│ │ │ │ │ ├── CompositionAopProxyTypeBuilder.cs
│ │ │ │ │ ├── DecoratorAopProxyTypeBuilder.cs
│ │ │ │ │ ├── DefaultAopProxyFactory.cs
│ │ │ │ │ ├── IAdvisedProxyMethodBuilder.cs
│ │ │ │ │ ├── IAopProxyTypeGenerator.cs
│ │ │ │ │ ├── InheritanceAopProxyTypeBuilder.cs
│ │ │ │ │ ├── IntroductionProxyMethodBuilder.cs
│ │ │ │ │ └── TargetAopProxyMethodBuilder.cs
│ │ │ │ ├── HashtableCachingAdvisorChainFactory.cs
│ │ │ │ ├── IAdvised.cs
│ │ │ │ ├── IAdvisedSupportListener.cs
│ │ │ │ ├── IAdvisorChainFactory.cs
│ │ │ │ ├── IAopProxy.cs
│ │ │ │ ├── IAopProxyFactory.cs
│ │ │ │ ├── InterceptorAndDynamicMethodMatcher.cs
│ │ │ │ ├── ITargetAware.cs
│ │ │ │ ├── ProxyConfig.cs
│ │ │ │ ├── ProxyFactory.cs
│ │ │ │ ├── ProxyFactoryObject.cs
│ │ │ │ └── ReflectiveMethodInvocation.cs
│ │ │ ├── IAdvisor.cs
│ │ │ ├── IAdvisors.cs
│ │ │ ├── IAfterReturningAdvice.cs
│ │ │ ├── IBeforeAdvice.cs
│ │ │ ├── IIntroductionAdvisor.cs
│ │ │ ├── IIntroductionInterceptor.cs
│ │ │ ├── IMethodBeforeAdvice.cs
│ │ │ ├── IMethodMatcher.cs
│ │ │ ├── IPointcutAdvisor.cs
│ │ │ ├── IPointcut.cs
│ │ │ ├── ITargetSource.cs
│ │ │ ├── IThrowsAdvice.cs
│ │ │ ├── ITypeFilter.cs
│ │ │ ├── Support
│ │ │ │ ├── AbstractGenericPointcutAdvisor.cs
│ │ │ │ ├── AbstractObjectFactoryPointcutAdvisor.cs
│ │ │ │ ├── AbstractPointcutAdvisor.cs
│ │ │ │ ├── AbstractRegularExpressionMethodPointcut.cs
│ │ │ │ ├── AttributeMatchingPointcut.cs
│ │ │ │ ├── AttributeMatchMethodPointcutAdvisor.cs
│ │ │ │ ├── AttributeMatchMethodPointcut.cs
│ │ │ │ ├── AttributeMethodMatcher.cs
│ │ │ │ ├── AttributeTypeFilter.cs
│ │ │ │ ├── ComposablePointcut.cs
│ │ │ │ ├── ControlFlowPointcut.cs
│ │ │ │ ├── DefaultIntroductionAdvisor.cs
│ │ │ │ ├── DefaultObjectFactoryPointcutAdvisor.cs
│ │ │ │ ├── DefaultPointcutAdvisor.cs
│ │ │ │ ├── DynamicMethodMatcher.cs
│ │ │ │ ├── DynamicMethodMatcherPointcutAdvisor.cs
│ │ │ │ ├── MethodMatchers.cs
│ │ │ │ ├── NameMatchMethodPointcutAdvisor.cs
│ │ │ │ ├── NameMatchMethodPointcut.cs
│ │ │ │ ├── Pointcuts.cs
│ │ │ │ ├── RegularExpressionMethodPointcutAdvisor.cs
│ │ │ │ ├── RootTypeFilter.cs
│ │ │ │ ├── SdkRegularExpressionMethodPointcut.cs
│ │ │ │ ├── StaticMethodMatcher.cs
│ │ │ │ ├── StaticMethodMatcherPointcutAdvisor.cs
│ │ │ │ ├── StaticMethodMatcherPointcut.cs
│ │ │ │ ├── TypeFilters.cs
│ │ │ │ ├── TypeNameTypeFilter.cs
│ │ │ │ └── UnionPointcut.cs
│ │ │ ├── Target
│ │ │ │ ├── AbstractPoolingTargetSource.cs
│ │ │ │ ├── AbstractPrototypeTargetSource.cs
│ │ │ │ ├── EmptyTargetSource.cs
│ │ │ │ ├── HotSwappableTargetSource.cs
│ │ │ │ ├── IThreadLocalTargetSourceStats.cs
│ │ │ │ ├── PoolingConfig.cs
│ │ │ │ ├── PrototypeTargetSource.cs
│ │ │ │ ├── SimplePoolTargetSource.cs
│ │ │ │ ├── SingletonTargetSource.cs
│ │ │ │ └── ThreadLocalTargetSource.cs
│ │ │ ├── TrueMethodMatcher.cs
│ │ │ ├── TruePointcut.cs
│ │ │ └── TrueTypeFilter.cs
│ │ ├── AopAlliance
│ │ │ ├── Aop
│ │ │ │ ├── AspectException.cs
│ │ │ │ └── IAdvice.cs
│ │ │ └── Intercept
│ │ │ ├── IConstructorInterceptor.cs
│ │ │ ├── IConstructorInvocation.cs
│ │ │ ├── IInterceptor.cs
│ │ │ ├── IInvocation.cs
│ │ │ ├── IJoinpoint.cs
│ │ │ ├── IMethodInterceptor.cs
│ │ │ └── IMethodInvocation.cs
│ │ ├── Aspects
│ │ │ ├── AbstractExceptionHandlerAdvice.cs
│ │ │ ├── AbstractExceptionHandler.cs
│ │ │ ├── Cache
│ │ │ │ ├── BaseCacheAdvice.cs
│ │ │ │ ├── CacheAspect.cs
│ │ │ │ ├── CacheParameterAdvice.cs
│ │ │ │ ├── CacheParameterAdvisor.cs
│ │ │ │ ├── CacheResultAdvice.cs
│ │ │ │ ├── CacheResultAdvisor.cs
│ │ │ │ ├── InvalidateCacheAdvice.cs
│ │ │ │ └── InvalidateCacheAdvisor.cs
│ │ │ ├── Exceptions
│ │ │ │ ├── ExceptionHandlerAdvice.cs
│ │ │ │ ├── ExecuteSpelExceptionHandler.cs
│ │ │ │ ├── LogExceptionHandler.cs
│ │ │ │ ├── ReturnValueExceptionHandler.cs
│ │ │ │ ├── SwallowExceptionHandler.cs
│ │ │ │ └── TranslationExceptionHandler.cs
│ │ │ ├── IExceptionHandler.cs
│ │ │ ├── Logging
│ │ │ │ ├── AbstractLoggingAdvice.cs
│ │ │ │ └── SimpleLoggingAdvice.cs
│ │ │ ├── ParsedAdviceExpression.cs
│ │ │ ├── RetryAdvice.cs
│ │ │ ├── RetryExceptionHandler.cs
│ │ │ └── Validation
│ │ │ ├── ParameterValidationAdvice.cs
│ │ │ └── ParameterValidationAdvisor.cs
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.Aop.2002.csproj
│ │ ├── Spring.Aop.2003.csproj
│ │ ├── Spring.Aop.2005.csproj
│ │ ├── Spring.Aop.2008.csproj
│ │ ├── Spring.Aop.2010.csproj
│ │ ├── Spring.Aop.build
│ │ ├── Spring.Aop.nuspec
│ │ └── Spring.Aop.xml
│ ├── Spring.Core
│ │ ├── AssemblyInfo.cs
│ │ ├── Caching
│ │ │ ├── AbstractCache.cs
│ │ │ ├── BaseCacheAttribute.cs
│ │ │ ├── CacheParameterAttribute.cs
│ │ │ ├── CacheResultAttribute.cs
│ │ │ ├── CacheResultItemsAttribute.cs
│ │ │ ├── ICache.cs
│ │ │ ├── InvalidateCacheAttribute.cs
│ │ │ └── NonExpiringCache.cs
│ │ ├── Collections
│ │ │ ├── AbstractQueue.cs
│ │ │ ├── CaseInsensitiveHashtable.cs
│ │ │ ├── DictionarySet.cs
│ │ │ ├── Generic
│ │ │ │ ├── DictionarySet.cs
│ │ │ │ ├── HashedSet.cs
│ │ │ │ ├── ImmutableSet.cs
│ │ │ │ ├── ISet.cs
│ │ │ │ ├── OrderedSet.cs
│ │ │ │ ├── ReadOnlyDictionary.cs
│ │ │ │ ├── Set.cs
│ │ │ │ ├── SortedSet.cs
│ │ │ │ └── SynchronizedSet.cs
│ │ │ ├── HashedSet.cs
│ │ │ ├── HybridSet.cs
│ │ │ ├── ImmutableSet.cs
│ │ │ ├── IQueue.cs
│ │ │ ├── ISet.cs
│ │ │ ├── LinkedList.cs
│ │ │ ├── ListSet.cs
│ │ │ ├── NoElementsException.cs
│ │ │ ├── PriorityQueue.cs
│ │ │ ├── Set.cs
│ │ │ ├── SortedSet.cs
│ │ │ ├── SynchronizedDictionaryEnumerator.cs
│ │ │ ├── SynchronizedEnumerator.cs
│ │ │ ├── SynchronizedHashtable.cs
│ │ │ └── SynchronizedSet.cs
│ │ ├── Context
│ │ │ ├── ApplicationContextException.cs
│ │ │ ├── ApplicationEventArgs.cs
│ │ │ ├── EventListenerAttribute.cs
│ │ │ ├── Events
│ │ │ │ ├── ConsoleListener.cs
│ │ │ │ └── ContextEventArgs.cs
│ │ │ ├── IApplicationContextAware.cs
│ │ │ ├── IApplicationContext.cs
│ │ │ ├── IApplicationEventListener.cs
│ │ │ ├── IApplicationEventPublisher.cs
│ │ │ ├── IConfigurableApplicationContext.cs
│ │ │ ├── IHierarchicalMessageSource.cs
│ │ │ ├── ILifecycle.cs
│ │ │ ├── IMessageSourceAware.cs
│ │ │ ├── IMessageSource.cs
│ │ │ ├── IMessageSourceResolvable.cs
│ │ │ ├── IResourceLoaderAware.cs
│ │ │ ├── NoSuchMessageException.cs
│ │ │ └── Support
│ │ │ ├── AbstractApplicationContext.cs
│ │ │ ├── AbstractMessageSource.cs
│ │ │ ├── AbstractXmlApplicationContextArgs.cs
│ │ │ ├── AbstractXmlApplicationContext.cs
│ │ │ ├── ApplicationContextAwareProcessor.cs
│ │ │ ├── ApplicationObjectSupport.cs
│ │ │ ├── ContextHandler.cs
│ │ │ ├── ContextRegistry.cs
│ │ │ ├── DefaultMessageSourceResolvable.cs
│ │ │ ├── DefaultSectionHandler.cs
│ │ │ ├── DelegatingMessageSource.cs
│ │ │ ├── GenericApplicationContext.cs
│ │ │ ├── MessageSourceAccessor.cs
│ │ │ ├── MessageSourceResolvableVisitor.cs
│ │ │ ├── NamespaceParsersSectionHandler.cs
│ │ │ ├── NullMessageSource.cs
│ │ │ ├── ResourceHandlersSectionHandler.cs
│ │ │ ├── ResourceSetMessageSource.cs
│ │ │ ├── StaticApplicationContext.cs
│ │ │ ├── StaticMessageSource.cs
│ │ │ ├── TypeAliasesSectionHandler.cs
│ │ │ ├── TypeConvertersSectionHandler.cs
│ │ │ ├── XmlApplicationContextArgs.cs
│ │ │ └── XmlApplicationContext.cs
│ │ ├── ContextClassDiagram.cd
│ │ ├── Core
│ │ │ ├── CannotLoadObjectTypeException.cs
│ │ │ ├── ComposedCriteria.cs
│ │ │ ├── ControlFlowFactory.cs
│ │ │ ├── Conventions.cs
│ │ │ ├── CriteriaMemberFilter.cs
│ │ │ ├── IControlFlow.cs
│ │ │ ├── ICriteria.cs
│ │ │ ├── IErrorCoded.cs
│ │ │ ├── InvalidPropertyException.cs
│ │ │ ├── IO
│ │ │ │ ├── AbstractResource.cs
│ │ │ │ ├── AssemblyResource.cs
│ │ │ │ ├── ConfigSectionResource.cs
│ │ │ │ ├── ConfigurableResourceLoader.cs
│ │ │ │ ├── EncodedResource.cs
│ │ │ │ ├── FileSystemResource.cs
│ │ │ │ ├── IInputStreamSource.cs
│ │ │ │ ├── InputStreamResource.cs
│ │ │ │ ├── IResource.cs
│ │ │ │ ├── IResourceLoader.cs
│ │ │ │ ├── ResourceConverter.cs
│ │ │ │ ├── ResourceHandlerRegistry.cs
│ │ │ │ ├── StringResource.cs
│ │ │ │ └── UrlResource.cs
│ │ │ ├── IOrdered.cs
│ │ │ ├── IPriorityOrdered.cs
│ │ │ ├── MethodArgumentsCriteria.cs
│ │ │ ├── MethodGenericArgumentsCountCriteria.cs
│ │ │ ├── MethodInvocationException.cs
│ │ │ ├── MethodNameMatchCriteria.cs
│ │ │ ├── MethodParameter.cs
│ │ │ ├── MethodParametersCountCriteria.cs
│ │ │ ├── MethodParametersCriteria.cs
│ │ │ ├── MethodReturnTypeCriteria.cs
│ │ │ ├── NotReadablePropertyException.cs
│ │ │ ├── NotWritablePropertyException.cs
│ │ │ ├── NullValueInNestedPathException.cs
│ │ │ ├── OrderComparator.cs
│ │ │ ├── PropertyAccessException.cs
│ │ │ ├── PropertyChangeEventArgs.cs
│ │ │ ├── RegularExpressionCriteria.cs
│ │ │ ├── RegularExpressionEventNameCriteria.cs
│ │ │ ├── RegularExpressionMethodNameCriteria.cs
│ │ │ ├── TypeConversion
│ │ │ │ ├── CredentialConverter.cs
│ │ │ │ ├── CustomNumberConverter.cs
│ │ │ │ ├── FileInfoConverter.cs
│ │ │ │ ├── NameValueConverter.cs
│ │ │ │ ├── RegexConverter.cs
│ │ │ │ ├── RegistryKeyConverter.cs
│ │ │ │ ├── ResourceManagerConverter.cs
│ │ │ │ ├── RGBColorConverter.cs
│ │ │ │ ├── RuntimeTypeConverter.cs
│ │ │ │ ├── StreamConverter.cs
│ │ │ │ ├── StringArrayConverter.cs
│ │ │ │ ├── TimeSpanConverter.cs
│ │ │ │ ├── TypeConversionUtils.cs
│ │ │ │ ├── TypeConverterRegistry.cs
│ │ │ │ ├── UniqueKeyConverter.cs
│ │ │ │ └── UriConverter.cs
│ │ │ ├── TypeMismatchException.cs
│ │ │ └── TypeResolution
│ │ │ ├── CachedTypeResolver.cs
│ │ │ ├── GenericArgumentsHolder.cs
│ │ │ ├── GenericTypeResolver.cs
│ │ │ ├── ITypeResolver.cs
│ │ │ ├── TypeAssemblyHolder.cs
│ │ │ ├── TypeRegistry.cs
│ │ │ ├── TypeResolutionUtils.cs
│ │ │ └── TypeResolver.cs
│ │ ├── DataBinding
│ │ │ ├── AbstractBinding.cs
│ │ │ ├── AbstractSimpleBinding.cs
│ │ │ ├── BaseBindingContainer.cs
│ │ │ ├── BaseBindingManager.cs
│ │ │ ├── BindingDirection.cs
│ │ │ ├── BindingErrorMessage.cs
│ │ │ ├── IBindingContainer.cs
│ │ │ ├── IBinding.cs
│ │ │ ├── IDataBound.cs
│ │ │ ├── ListBinding.cs
│ │ │ └── SimpleExpressionBinding.cs
│ │ ├── Expressions
│ │ │ ├── ArrayConstructorNode.cs
│ │ │ ├── AssignNode.cs
│ │ │ ├── AttributeNode.cs
│ │ │ ├── BaseNode.cs
│ │ │ ├── BinaryOperator.cs
│ │ │ ├── BooleanLiteralNode.cs
│ │ │ ├── ConstructorNode.cs
│ │ │ ├── DefaultNode.cs
│ │ │ ├── ExpressionConverter.cs
│ │ │ ├── Expression.cs
│ │ │ ├── ExpressionEvaluator.cs
│ │ │ ├── Expression.g
│ │ │ ├── ExpressionListNode.cs
│ │ │ ├── FunctionNode.cs
│ │ │ ├── HexLiteralNode.cs
│ │ │ ├── IExpression.cs
│ │ │ ├── IndexerNode.cs
│ │ │ ├── IntLiteralNode.cs
│ │ │ ├── LambdaExpressionNode.cs
│ │ │ ├── ListInitializerNode.cs
│ │ │ ├── LocalFunctionNode.cs
│ │ │ ├── LocalVariableNode.cs
│ │ │ ├── MapEntryNode.cs
│ │ │ ├── MapInitializerNode.cs
│ │ │ ├── MethodNode.cs
│ │ │ ├── NamedArgumentNode.cs
│ │ │ ├── NodeWithArguments.cs
│ │ │ ├── NullLiteralNode.cs
│ │ │ ├── OpADD.cs
│ │ │ ├── OpAND.cs
│ │ │ ├── OpBetween.cs
│ │ │ ├── OpDIVIDE.cs
│ │ │ ├── OpEqual.cs
│ │ │ ├── OpGreater.cs
│ │ │ ├── OpGreaterOrEqual.cs
│ │ │ ├── OpIn.cs
│ │ │ ├── OpIs.cs
│ │ │ ├── OpLess.cs
│ │ │ ├── OpLessOrEqual.cs
│ │ │ ├── OpLike.cs
│ │ │ ├── OpMatches.cs
│ │ │ ├── OpMODULUS.cs
│ │ │ ├── OpMULTIPLY.cs
│ │ │ ├── OpNOT.cs
│ │ │ ├── OpNotEqual.cs
│ │ │ ├── OpOR.cs
│ │ │ ├── OpPOWER.cs
│ │ │ ├── OpSUBTRACT.cs
│ │ │ ├── OpUnaryMinus.cs
│ │ │ ├── OpUnaryPlus.cs
│ │ │ ├── OpXOR.cs
│ │ │ ├── Parser
│ │ │ │ ├── antlr
│ │ │ │ │ ├── ANTLRException.cs
│ │ │ │ │ ├── ANTLRPanicException.cs
│ │ │ │ │ ├── ASTFactory.cs
│ │ │ │ │ ├── ASTNodeCreator.cs
│ │ │ │ │ ├── ASTNULLType.cs
│ │ │ │ │ ├── ASTPair.cs
│ │ │ │ │ ├── ASTVisitor.cs
│ │ │ │ │ ├── BaseAST.cs
│ │ │ │ │ ├── ByteBuffer.cs
│ │ │ │ │ ├── CharBuffer.cs
│ │ │ │ │ ├── CharQueue.cs
│ │ │ │ │ ├── CharScanner.cs
│ │ │ │ │ ├── CharStreamException.cs
│ │ │ │ │ ├── CharStreamIOException.cs
│ │ │ │ │ ├── collections
│ │ │ │ │ │ ├── AST.cs
│ │ │ │ │ │ └── impl
│ │ │ │ │ │ ├── ASTArray.cs
│ │ │ │ │ │ └── BitSet.cs
│ │ │ │ │ ├── CommonAST.cs
│ │ │ │ │ ├── CommonASTWithHiddenTokens.cs
│ │ │ │ │ ├── CommonHiddenStreamToken.cs
│ │ │ │ │ ├── CommonToken.cs
│ │ │ │ │ ├── debug
│ │ │ │ │ │ ├── ANTLREventArgs.cs
│ │ │ │ │ │ ├── DebuggingCharScanner.cs
│ │ │ │ │ │ ├── DebuggingInputBuffer.cs
│ │ │ │ │ │ ├── DebuggingParser.cs
│ │ │ │ │ │ ├── GuessingEventArgs.cs
│ │ │ │ │ │ ├── ICharScannerDebugSubject.cs
│ │ │ │ │ │ ├── IDebugSubject.cs
│ │ │ │ │ │ ├── InputBufferEventArgs.cs
│ │ │ │ │ │ ├── InputBufferEventSupport.cs
│ │ │ │ │ │ ├── InputBufferListenerBase.cs
│ │ │ │ │ │ ├── InputBufferListener.cs
│ │ │ │ │ │ ├── InputBufferReporter.cs
│ │ │ │ │ │ ├── IParserDebugSubject.cs
│ │ │ │ │ │ ├── Listener.cs
│ │ │ │ │ │ ├── LLkDebuggingParser.cs
│ │ │ │ │ │ ├── MessageEventArgs.cs
│ │ │ │ │ │ ├── MessageListenerBase.cs
│ │ │ │ │ │ ├── MessageListener.cs
│ │ │ │ │ │ ├── NewLineEventArgs.cs
│ │ │ │ │ │ ├── NewLineListener.cs
│ │ │ │ │ │ ├── ParserController.cs
│ │ │ │ │ │ ├── ParserEventSupport.cs
│ │ │ │ │ │ ├── ParserListenerBase.cs
│ │ │ │ │ │ ├── ParserListener.cs
│ │ │ │ │ │ ├── ParserMatchEventArgs.cs
│ │ │ │ │ │ ├── ParserMatchListenerBase.cs
│ │ │ │ │ │ ├── ParserMatchListener.cs
│ │ │ │ │ │ ├── ParserReporter.cs
│ │ │ │ │ │ ├── ParserTokenEventArgs.cs
│ │ │ │ │ │ ├── ParserTokenListenerBase.cs
│ │ │ │ │ │ ├── ParserTokenListener.cs
│ │ │ │ │ │ ├── ParseTreeDebugParser.cs
│ │ │ │ │ │ ├── ScannerEventSupport.cs
│ │ │ │ │ │ ├── SemanticPredicateEventArgs.cs
│ │ │ │ │ │ ├── SemanticPredicateListenerBase.cs
│ │ │ │ │ │ ├── SemanticPredicateListener.cs
│ │ │ │ │ │ ├── SyntacticPredicateEventArgs.cs
│ │ │ │ │ │ ├── SyntacticPredicateListenerBase.cs
│ │ │ │ │ │ ├── SyntacticPredicateListener.cs
│ │ │ │ │ │ ├── TraceEventArgs.cs
│ │ │ │ │ │ ├── TraceListenerBase.cs
│ │ │ │ │ │ ├── TraceListener.cs
│ │ │ │ │ │ └── Tracer.cs
│ │ │ │ │ ├── DefaultFileLineFormatter.cs
│ │ │ │ │ ├── DumpASTVisitor.cs
│ │ │ │ │ ├── FileLineFormatter.cs
│ │ │ │ │ ├── IHiddenStreamToken.cs
│ │ │ │ │ ├── InputBuffer.cs
│ │ │ │ │ ├── IToken.cs
│ │ │ │ │ ├── LexerSharedInputState.cs
│ │ │ │ │ ├── LLkParser.cs
│ │ │ │ │ ├── MismatchedCharException.cs
│ │ │ │ │ ├── MismatchedTokenException.cs
│ │ │ │ │ ├── NoViableAltException.cs
│ │ │ │ │ ├── NoViableAltForCharException.cs
│ │ │ │ │ ├── Parser.cs
│ │ │ │ │ ├── ParserSharedInputState.cs
│ │ │ │ │ ├── ParseTree.cs
│ │ │ │ │ ├── ParseTreeRule.cs
│ │ │ │ │ ├── ParseTreeToken.cs
│ │ │ │ │ ├── RecognitionException.cs
│ │ │ │ │ ├── SemanticException.cs
│ │ │ │ │ ├── StringUtils.cs
│ │ │ │ │ ├── SupportClass.cs
│ │ │ │ │ ├── TokenBuffer.cs
│ │ │ │ │ ├── TokenCreator.cs
│ │ │ │ │ ├── Token.cs
│ │ │ │ │ ├── TokenQueue.cs
│ │ │ │ │ ├── TokenStreamBasicFilter.cs
│ │ │ │ │ ├── TokenStream.cs
│ │ │ │ │ ├── TokenStreamException.cs
│ │ │ │ │ ├── TokenStreamHiddenTokenFilter.cs
│ │ │ │ │ ├── TokenStreamIOException.cs
│ │ │ │ │ ├── TokenStreamRecognitionException.cs
│ │ │ │ │ ├── TokenStreamRetryException.cs
│ │ │ │ │ ├── TokenStreamRewriteEngine.cs
│ │ │ │ │ ├── TokenStreamSelector.cs
│ │ │ │ │ ├── TokenWithIndex.cs
│ │ │ │ │ ├── TreeParser.cs
│ │ │ │ │ └── TreeParserSharedInputState.cs
│ │ │ │ ├── ExpressionLexer.cs
│ │ │ │ ├── ExpressionParser.cs
│ │ │ │ ├── ExpressionParserTokenTypes.cs
│ │ │ │ └── ExpressionParserTokenTypes.txt
│ │ │ ├── Processors
│ │ │ │ ├── AverageAggregator.cs
│ │ │ │ ├── ConversionProcessor.cs
│ │ │ │ ├── CountAggregator.cs
│ │ │ │ ├── DateConversionProcessor.cs
│ │ │ │ ├── DistinctProcessor.cs
│ │ │ │ ├── ICollectionProcessor.cs
│ │ │ │ ├── IMethodCallProcessor.cs
│ │ │ │ ├── MaxAggregator.cs
│ │ │ │ ├── MinAggregator.cs
│ │ │ │ ├── NonNullProcessor.cs
│ │ │ │ ├── OrderByProcessor.cs
│ │ │ │ ├── ReverseProcessor.cs
│ │ │ │ ├── SortProcessor.cs
│ │ │ │ └── SumAggregator.cs
│ │ │ ├── ProjectionNode.cs
│ │ │ ├── PropertyOrFieldNode.cs
│ │ │ ├── QualifiedIdentifier.cs
│ │ │ ├── RealLiteralNode.cs
│ │ │ ├── ReferenceNode.cs
│ │ │ ├── SelectionFirstNode.cs
│ │ │ ├── SelectionLastNode.cs
│ │ │ ├── SelectionNode.cs
│ │ │ ├── SpringAST.cs
│ │ │ ├── StringLiteralNode.cs
│ │ │ ├── SyntaxErrorException.cs
│ │ │ ├── TernaryNode.cs
│ │ │ ├── TypeNode.cs
│ │ │ ├── UnaryOperator.cs
│ │ │ └── VariableNode.cs
│ │ ├── Globalization
│ │ │ ├── AbstractLocalizer.cs
│ │ │ ├── AbstractResourceCache.cs
│ │ │ ├── Formatters
│ │ │ │ ├── BooleanFormatter.cs
│ │ │ │ ├── CurrencyFormatter.cs
│ │ │ │ ├── DateTimeFormatter.cs
│ │ │ │ ├── FilteringFormatter.cs
│ │ │ │ ├── FloatFormatter.cs
│ │ │ │ ├── HasTextFilteringFormatter.cs
│ │ │ │ ├── IntegerFormatter.cs
│ │ │ │ ├── NullFormatter.cs
│ │ │ │ ├── NumberFormatter.cs
│ │ │ │ └── PercentFormatter.cs
│ │ │ ├── ICultureResolver.cs
│ │ │ ├── IFormatter.cs
│ │ │ ├── ILocalizer.cs
│ │ │ ├── IResourceCache.cs
│ │ │ ├── Localizers
│ │ │ │ └── ResourceSetLocalizer.cs
│ │ │ ├── NullResourceCache.cs
│ │ │ ├── Resolvers
│ │ │ │ └── DefaultCultureResolver.cs
│ │ │ └── Resource.cs
│ │ ├── Objects
│ │ │ ├── Events
│ │ │ │ ├── IEventRegistryAware.cs
│ │ │ │ ├── IEventRegistry.cs
│ │ │ │ └── Support
│ │ │ │ ├── EventManipulationUtils.cs
│ │ │ │ └── EventRegistry.cs
│ │ │ ├── Factory
│ │ │ │ ├── Attributes
│ │ │ │ │ ├── RequiredAttribute.cs
│ │ │ │ │ └── RequiredAttributeObjectPostProcessor.cs
│ │ │ │ ├── Config
│ │ │ │ │ ├── AbstractConfigurer.cs
│ │ │ │ │ ├── AbstractFactoryObject.cs
│ │ │ │ │ ├── AutoWiringMode.cs
│ │ │ │ │ ├── CommandLineArgsVariableSource.cs
│ │ │ │ │ ├── ConfigSectionVariableSource.cs
│ │ │ │ │ ├── ConfigurableVariableSource.cs
│ │ │ │ │ ├── ConfigurationReader.cs
│ │ │ │ │ ├── ConnectionStringsVariableSource.cs
│ │ │ │ │ ├── ConstructorArgumentValues.cs
│ │ │ │ │ ├── CustomConverterConfigurer.cs
│ │ │ │ │ ├── DelegateFactoryObject.cs
│ │ │ │ │ ├── DelegateObjectFactoryConfigurer.cs
│ │ │ │ │ ├── DependencyDescriptor.cs
│ │ │ │ │ ├── DictionaryFactoryObject.cs
│ │ │ │ │ ├── DictionaryVariableSource.cs
│ │ │ │ │ ├── EnvironmentVariableMode.cs
│ │ │ │ │ ├── EnvironmentVariableSource.cs
│ │ │ │ │ ├── EventValues.cs
│ │ │ │ │ ├── ExpressionHolder.cs
│ │ │ │ │ ├── FieldRetrievingFactoryObject.cs
│ │ │ │ │ ├── IAutowireCapableObjectFactory.cs
│ │ │ │ │ ├── IConfigurableFactoryObject.cs
│ │ │ │ │ ├── IConfigurableListableObjectFactory.cs
│ │ │ │ │ ├── IConfigurableObjectFactory.cs
│ │ │ │ │ ├── ICustomValueReferenceHolder.cs
│ │ │ │ │ ├── IDestructionAwareObjectPostProcessor.cs
│ │ │ │ │ ├── IInstantiationAwareObjectPostProcessor.cs
│ │ │ │ │ ├── IManagedCollection.cs
│ │ │ │ │ ├── InstantiationAwareObjectPostProcessorAdapter.cs
│ │ │ │ │ ├── IObjectDefinition.cs
│ │ │ │ │ ├── IObjectFactoryPostProcessor.cs
│ │ │ │ │ ├── IObjectPostProcessor.cs
│ │ │ │ │ ├── ISingletonObjectRegistry.cs
│ │ │ │ │ ├── IVariableSource.cs
│ │ │ │ │ ├── ListFactoryObject.cs
│ │ │ │ │ ├── LogFactoryObject.cs
│ │ │ │ │ ├── ManagedDictionary.cs
│ │ │ │ │ ├── ManagedList.cs
│ │ │ │ │ ├── ManagedNameValueCollection.cs
│ │ │ │ │ ├── ManagedSet.cs
│ │ │ │ │ ├── MethodInvokingFactoryObject.cs
│ │ │ │ │ ├── ObjectDefinitionHolder.cs
│ │ │ │ │ ├── ObjectDefinitionVisitor.cs
│ │ │ │ │ ├── ObjectFactoryCreatingFactoryObject.cs
│ │ │ │ │ ├── ObjectReferenceFactoryObject.cs
│ │ │ │ │ ├── ObjectRole.cs
│ │ │ │ │ ├── PropertyFileVariableSource.cs
│ │ │ │ │ ├── PropertyOverrideConfigurer.cs
│ │ │ │ │ ├── PropertyPathFactoryObject.cs
│ │ │ │ │ ├── PropertyPlaceholderConfigurer.cs
│ │ │ │ │ ├── PropertyResourceConfigurer.cs
│ │ │ │ │ ├── PropertyRetrievingFactoryObject.cs
│ │ │ │ │ ├── RegistryVariableSource.cs
│ │ │ │ │ ├── ResourceHandlerConfigurer.cs
│ │ │ │ │ ├── ResourceManagerFactoryObject.cs
│ │ │ │ │ ├── RuntimeObjectReference.cs
│ │ │ │ │ ├── SetFactoryObject.cs
│ │ │ │ │ ├── SharedStateAwareProcessor.cs
│ │ │ │ │ ├── SmartInstantiationAwareObjectPostProcessor.cs
│ │ │ │ │ ├── SpecialFolderVariableSource.cs
│ │ │ │ │ ├── TypeAliasConfigurer.cs
│ │ │ │ │ ├── TypedStringValue.cs
│ │ │ │ │ ├── VariableAccessor.cs
│ │ │ │ │ └── VariablePlaceholderConfigurer.cs
│ │ │ │ ├── FactoryObjectNotInitializedException.cs
│ │ │ │ ├── IFactoryObject.cs
│ │ │ │ ├── IGenericObjectFactory.cs
│ │ │ │ ├── IHierarchicalObjectFactory.cs
│ │ │ │ ├── IInitializingObject.cs
│ │ │ │ ├── IListableObjectFactory.cs
│ │ │ │ ├── IObjectDefinitionFactory.cs
│ │ │ │ ├── IObjectFactoryAware.cs
│ │ │ │ ├── IObjectFactory.cs
│ │ │ │ ├── IObjectNameAware.cs
│ │ │ │ ├── NoSuchObjectDefinitionException.cs
│ │ │ │ ├── ObjectCreationException.cs
│ │ │ │ ├── ObjectCurrentlyInCreationException.cs
│ │ │ │ ├── ObjectDefinitionException.cs
│ │ │ │ ├── ObjectDefinitionStoreException.cs
│ │ │ │ ├── ObjectFactoryUtils.cs
│ │ │ │ ├── ObjectInitializationException.cs
│ │ │ │ ├── ObjectIsNotAFactoryException.cs
│ │ │ │ ├── ObjectNotOfRequiredTypeException.cs
│ │ │ │ ├── Parsing
│ │ │ │ │ ├── FailFastProblemReporter.cs
│ │ │ │ │ ├── IProblemReporter.cs
│ │ │ │ │ ├── Location.cs
│ │ │ │ │ ├── ObjectDefinitionParsingException.cs
│ │ │ │ │ ├── Problem.cs
│ │ │ │ │ └── ReaderContext.cs
│ │ │ │ ├── Support
│ │ │ │ │ ├── AbstractAutowireCapableObjectFactory.cs
│ │ │ │ │ ├── AbstractMethodReplacer.cs
│ │ │ │ │ ├── AbstractObjectDefinition.cs
│ │ │ │ │ ├── AbstractObjectDefinitionReader.cs
│ │ │ │ │ ├── AbstractObjectFactory.cs
│ │ │ │ │ ├── AutowireUtils.cs
│ │ │ │ │ ├── ChildObjectDefinition.cs
│ │ │ │ │ ├── ConstructorResolver.cs
│ │ │ │ │ ├── DefaultListableObjectFactory.cs
│ │ │ │ │ ├── DefaultObjectDefinitionFactory.cs
│ │ │ │ │ ├── DefaultObjectNameGenerator.cs
│ │ │ │ │ ├── DelegatingMethodReplacer.cs
│ │ │ │ │ ├── DependencyCheckingMode.cs
│ │ │ │ │ ├── GenericObjectDefinition.cs
│ │ │ │ │ ├── IAutowireCandidateResolver.cs
│ │ │ │ │ ├── IConfigurableObjectDefinition.cs
│ │ │ │ │ ├── IInstantiationStrategy.cs
│ │ │ │ │ ├── IMethodReplacer.cs
│ │ │ │ │ ├── IObjectDefinitionReader.cs
│ │ │ │ │ ├── IObjectDefinitionRegistry.cs
│ │ │ │ │ ├── IObjectDefinitionRegistryPostProcessor.cs
│ │ │ │ │ ├── IObjectNameGenerator.cs
│ │ │ │ │ ├── LookupMethodOverride.cs
│ │ │ │ │ ├── LookupMethodReplacer.cs
│ │ │ │ │ ├── MethodInjectingInstantiationStrategy.cs
│ │ │ │ │ ├── MethodOverride.cs
│ │ │ │ │ ├── MethodOverrides.cs
│ │ │ │ │ ├── ObjectDefinitionBuilder.cs
│ │ │ │ │ ├── ObjectDefinitionReaderUtils.cs
│ │ │ │ │ ├── ObjectDefinitionValidationException.cs
│ │ │ │ │ ├── ObjectDefinitionValueResolver.cs
│ │ │ │ │ ├── ObjectScope.cs
│ │ │ │ │ ├── PropertiesObjectDefinitionReader.cs
│ │ │ │ │ ├── RootObjectDefinition.cs
│ │ │ │ │ ├── SimpleAutowireCandidateResolver.cs
│ │ │ │ │ ├── SimpleInstantiationStrategy.cs
│ │ │ │ │ └── StaticListableObjectFactory.cs
│ │ │ │ ├── UnsatisfiedDependencyException.cs
│ │ │ │ └── Xml
│ │ │ │ ├── AbstractObjectDefinitionParser.cs
│ │ │ │ ├── AbstractSimpleObjectDefinitionParser.cs
│ │ │ │ ├── AbstractSingleObjectDefinitionParser.cs
│ │ │ │ ├── DefaultNamespaceHandlerResolver.cs
│ │ │ │ ├── DefaultObjectDefinitionDocumentReader.cs
│ │ │ │ ├── DocumentDefaultsDefinition.cs
│ │ │ │ ├── INamespaceParser.cs
│ │ │ │ ├── INamespaceParserResolver.cs
│ │ │ │ ├── IObjectDefinitionDocumentReader.cs
│ │ │ │ ├── IObjectDefinitionParser.cs
│ │ │ │ ├── NamespaceParserAttribute.cs
│ │ │ │ ├── NamespaceParserRegistry.cs
│ │ │ │ ├── NamespaceParserSupport.cs
│ │ │ │ ├── ObjectDefinitionConstants.cs
│ │ │ │ ├── ObjectDefinitionParserHelper.cs
│ │ │ │ ├── ObjectFactorySectionHandler.cs
│ │ │ │ ├── ObjectsNamespaceParser.cs
│ │ │ │ ├── ParserContext.cs
│ │ │ │ ├── ReplacedMethodOverride.cs
│ │ │ │ ├── spring-objects-1.1.xsd
│ │ │ │ ├── spring-objects-1.1.xsx
│ │ │ │ ├── spring-objects-1.3.xsd
│ │ │ │ ├── spring-objects-1.3.xsx
│ │ │ │ ├── spring-tool-1.1.xsd
│ │ │ │ ├── XmlObjectDefinitionReader.cs
│ │ │ │ ├── XmlObjectFactory.cs
│ │ │ │ └── XmlReaderContext.cs
│ │ │ ├── FatalObjectException.cs
│ │ │ ├── IEventHandlerValue.cs
│ │ │ ├── IMergable.cs
│ │ │ ├── IObjectWrapper.cs
│ │ │ ├── IPropertyValues.cs
│ │ │ ├── ISharedStateAware.cs
│ │ │ ├── ISharedStateFactory.cs
│ │ │ ├── MutablePropertyValues.cs
│ │ │ ├── ObjectsException.cs
│ │ │ ├── ObjectWrapper.cs
│ │ │ ├── PropertyAccessExceptionsException.cs
│ │ │ ├── PropertyValue.cs
│ │ │ └── Support
│ │ │ ├── AbstractEventHandlerValue.cs
│ │ │ ├── AbstractSharedStateFactory.cs
│ │ │ ├── AbstractWiringEventHandlerValue.cs
│ │ │ ├── ArgumentConvertingMethodInvoker.cs
│ │ │ ├── AutoWiringEventHandlerValue.cs
│ │ │ ├── ByTypeSharedStateFactory.cs
│ │ │ ├── InstanceEventHandlerValue.cs
│ │ │ ├── ISortDefinition.cs
│ │ │ ├── MethodInvoker.cs
│ │ │ ├── MutableSortDefinition.cs
│ │ │ ├── PropertyComparator.cs
│ │ │ └── StaticEventHandlerValue.cs
│ │ ├── Pool
│ │ │ ├── IObjectPool.cs
│ │ │ ├── IPoolableObjectFactory.cs
│ │ │ ├── PoolException.cs
│ │ │ └── Support
│ │ │ └── SimplePool.cs
│ │ ├── Proxy
│ │ │ ├── AbstractProxyMethodBuilder.cs
│ │ │ ├── AbstractProxyTypeBuilder.cs
│ │ │ ├── BaseProxyMethodBuilder.cs
│ │ │ ├── CompositionProxyTypeBuilder.cs
│ │ │ ├── DynamicProxyManager.cs
│ │ │ ├── InheritanceProxyTypeBuilder.cs
│ │ │ ├── IProxyMethodBuilder.cs
│ │ │ ├── IProxyTypeBuilder.cs
│ │ │ ├── IProxyTypeGenerator.cs
│ │ │ ├── ProxyIgnoreAttribute.cs
│ │ │ └── TargetProxyMethodBuilder.cs
│ │ ├── README_ANTLR.txt
│ │ ├── Reflection
│ │ │ └── Dynamic
│ │ │ ├── BaseDynamicMember.cs
│ │ │ ├── DynamicConstructor.cs
│ │ │ ├── DynamicField.cs
│ │ │ ├── DynamicIndexer.cs
│ │ │ ├── DynamicMethod.cs
│ │ │ ├── DynamicProperty.cs
│ │ │ └── DynamicReflectionManager.cs
│ │ ├── Resources
│ │ │ └── Strings.resx
│ │ ├── Spring.Core.2002.csproj
│ │ ├── Spring.Core.2003.csproj
│ │ ├── Spring.Core.2005.csproj
│ │ ├── Spring.Core.2008.csproj
│ │ ├── Spring.Core.2010.csproj
│ │ ├── Spring.Core.build
│ │ ├── Spring.Core.nuspec
│ │ ├── Spring.Core.xml
│ │ ├── Stereotype
│ │ │ ├── ComponentAttribute.cs
│ │ │ ├── RepositoryAttribute.cs
│ │ │ └── ServiceAttribute.cs
│ │ ├── Threading
│ │ │ ├── CallContextStorage.cs
│ │ │ ├── ISync.cs
│ │ │ ├── IThreadStorage.cs
│ │ │ ├── Latch.cs
│ │ │ ├── LogicalThreadContext.cs
│ │ │ ├── Semaphore.cs
│ │ │ ├── SyncHolder.cs
│ │ │ ├── ThreadStaticStorage.cs
│ │ │ ├── TimeoutException.cs
│ │ │ ├── TimeoutSync.cs
│ │ │ └── Utils.cs
│ │ ├── Util
│ │ │ ├── ArrayUtils.cs
│ │ │ ├── AssertUtils.cs
│ │ │ ├── AttributeUtils.cs
│ │ │ ├── CollectionUtils.cs
│ │ │ ├── CompareUtils.cs
│ │ │ ├── ConfigurationUtils.cs
│ │ │ ├── ConfigXmlAttribute.cs
│ │ │ ├── ConfigXmlDocument.cs
│ │ │ ├── ConfigXmlElement.cs
│ │ │ ├── ConstructorInstantiationInfo.cs
│ │ │ ├── DelegateInfo.cs
│ │ │ ├── DynamicCodeManager.cs
│ │ │ ├── EventUtils.cs
│ │ │ ├── FatalReflectionException.cs
│ │ │ ├── Generic
│ │ │ │ └── CollectionUtils.cs
│ │ │ ├── IChainableConfigSystem.cs
│ │ │ ├── IErrorHandler.cs
│ │ │ ├── IEventExceptionsCollector.cs
│ │ │ ├── IoUtils.cs
│ │ │ ├── ITextPosition.cs
│ │ │ ├── NumberUtils.cs
│ │ │ ├── ObjectUtils.cs
│ │ │ ├── PathMatcher.cs
│ │ │ ├── PatternMatchUtils.cs
│ │ │ ├── Properties.cs
│ │ │ ├── ReflectionException.cs
│ │ │ ├── ReflectionUtils.cs
│ │ │ ├── SecurityCritical.cs
│ │ │ ├── StringUtils.cs
│ │ │ ├── SystemUtils.cs
│ │ │ ├── TextPositionInfo.cs
│ │ │ ├── UniqueKey.cs
│ │ │ └── XmlUtils.cs
│ │ └── Validation
│ │ ├── Actions
│ │ │ ├── ErrorMessageAction.cs
│ │ │ ├── ExceptionAction.cs
│ │ │ └── ExpressionAction.cs
│ │ ├── AnyValidatorGroup.cs
│ │ ├── BaseSimpleValidator.cs
│ │ ├── BaseValidationAction.cs
│ │ ├── BaseValidator.cs
│ │ ├── BaseValidatorGroup.cs
│ │ ├── CollectionValidator.cs
│ │ ├── Config
│ │ │ ├── spring-validation-1.1.xsd
│ │ │ ├── spring-validation-1.3.xsd
│ │ │ └── ValidationNamespaceParser.cs
│ │ ├── ErrorMessage.cs
│ │ ├── ExclusiveValidatorGroup.cs
│ │ ├── IValidationAction.cs
│ │ ├── IValidationErrors.cs
│ │ ├── IValidator.cs
│ │ ├── ValidatedAttribute.cs
│ │ ├── ValidationErrors.cs
│ │ ├── ValidationException.cs
│ │ ├── ValidatorGroup.cs
│ │ ├── ValidatorReference.cs
│ │ └── Validators
│ │ ├── ConditionValidator.cs
│ │ ├── CreditCardValidator.cs
│ │ ├── EmailValidator.cs
│ │ ├── ISBNValidator.cs
│ │ ├── RegularExpressionValidator.cs
│ │ ├── RequiredValidator.cs
│ │ └── UrlValidator.cs
│ ├── Spring.Data
│ │ ├── AssemblyInfo.cs
│ │ ├── Dao
│ │ │ ├── Attributes
│ │ │ │ ├── PersistenceExceptionTranslationAdvisor.cs
│ │ │ │ └── PersistenceExceptionTranslationPostProcessor.cs
│ │ │ ├── CannotAcquireLockException.cs
│ │ │ ├── CannotSerializeTransactionException.cs
│ │ │ ├── CleanupFailureDataAccessException.cs
│ │ │ ├── ConcurrencyFailureException.cs
│ │ │ ├── DataAccessException.cs
│ │ │ ├── DataAccessResourceFailureException.cs
│ │ │ ├── DataIntegrityViolationException.cs
│ │ │ ├── DataRetrievalFailureException.cs
│ │ │ ├── DeadlockLoserDataAccessException.cs
│ │ │ ├── EmptyResultDataAccessException.cs
│ │ │ ├── IncorrectResultSizeDataAccessException.cs
│ │ │ ├── IncorrectUpdateSemanticsDataAccessException.cs
│ │ │ ├── InvalidDataAccessApiUsageException.cs
│ │ │ ├── InvalidDataAccessResourceUsageException.cs
│ │ │ ├── NonTransientDataAccessException.cs
│ │ │ ├── NonTransientDataAccessResourceException.cs
│ │ │ ├── ObjectOptimisticLockingFailureException.cs
│ │ │ ├── ObjectRetrievalFailureException.cs
│ │ │ ├── OptimisticLockingFailureException.cs
│ │ │ ├── PermissionDeniedDataAccessException.cs
│ │ │ ├── PessimisticLockingFailureException.cs
│ │ │ ├── Support
│ │ │ │ ├── ChainedPersistenceExceptionTranslator.cs
│ │ │ │ ├── DaoSupport.cs
│ │ │ │ ├── DataAccessUtils.cs
│ │ │ │ ├── Generic
│ │ │ │ │ └── DataAccessUtils.cs
│ │ │ │ ├── IPersistenceExceptionTranslator.cs
│ │ │ │ └── PersistenceExceptionTranslationInterceptor.cs
│ │ │ ├── TransientDataAccessException.cs
│ │ │ ├── TransientDataAccessResourceException.cs
│ │ │ ├── TypeMismatchDataAccessException.cs
│ │ │ └── UncategorizedDataAccessException.cs
│ │ ├── Data
│ │ │ ├── BadSqlGrammarException.cs
│ │ │ ├── CannotGetAdoConnectionException.cs
│ │ │ ├── CommandDelegate.cs
│ │ │ ├── CommandSetterDelegate.cs
│ │ │ ├── Common
│ │ │ │ ├── DbMetadata.cs
│ │ │ │ ├── DbParameter.cs
│ │ │ │ ├── DbParametersBuilder.cs
│ │ │ │ ├── DbParameters.cs
│ │ │ │ ├── DbProviderConfigurer.cs
│ │ │ │ ├── DbProvider.cs
│ │ │ │ ├── DbProviderFactory.cs
│ │ │ │ ├── DbProviderFactoryObject.cs
│ │ │ │ ├── dbproviders.xml
│ │ │ │ ├── DelegatingDbProvider.cs
│ │ │ │ ├── ErrorCodes.cs
│ │ │ │ ├── IDbMetadata.cs
│ │ │ │ ├── IDbParameter.cs
│ │ │ │ ├── IDbParametersBuilder.cs
│ │ │ │ ├── IDbParameters.cs
│ │ │ │ ├── IDbProvider.cs
│ │ │ │ ├── MultiDelegatingDbProvider.cs
│ │ │ │ └── UserCredentialsDbProvider.cs
│ │ │ ├── Config
│ │ │ │ ├── DatabaseNamespaceParser.cs
│ │ │ │ ├── spring-database-1.1.xsd
│ │ │ │ ├── spring-database-1.1.xsx
│ │ │ │ ├── spring-database-1.3.xsd
│ │ │ │ └── spring-database-1.3.xsx
│ │ │ ├── Core
│ │ │ │ ├── AdoAccessor.cs
│ │ │ │ ├── AdoDaoSupport.cs
│ │ │ │ ├── AdoPlatformTransactionManager.cs
│ │ │ │ ├── AdoTemplate.cs
│ │ │ │ ├── RowMapperResultSetExtractor.cs
│ │ │ │ ├── ServiceDomainPlatformTransactionManager.cs
│ │ │ │ └── TxScopeTransactionManager.cs
│ │ │ ├── DuplicateKeyException.cs
│ │ │ ├── Generic
│ │ │ │ ├── AdoDaoSupport.cs
│ │ │ │ ├── AdoTemplate.cs
│ │ │ │ ├── CommandDelegate.cs
│ │ │ │ ├── DataAdapterDelegate.cs
│ │ │ │ ├── IAdoOperations.cs
│ │ │ │ ├── ICommandCallback.cs
│ │ │ │ ├── IDataAdapterCallback.cs
│ │ │ │ ├── IDbCommandCallback.cs
│ │ │ │ ├── IDbCommandDelegate.cs
│ │ │ │ ├── IResultSetExtractor.cs
│ │ │ │ ├── IRowMapper.cs
│ │ │ │ ├── NamedResultSetProcessor.cs
│ │ │ │ ├── ResultSetExtractorDelegate.cs
│ │ │ │ ├── RowMapperDelegate.cs
│ │ │ │ └── RowMapperResultSetExtractor.cs
│ │ │ ├── IAdoOperations.cs
│ │ │ ├── ICommandCallback.cs
│ │ │ ├── ICommandSetter.cs
│ │ │ ├── ICommandTextProvider.cs
│ │ │ ├── ICommonAdoOperations.cs
│ │ │ ├── IDataAdapterCallback.cs
│ │ │ ├── IDataAdapterSetter.cs
│ │ │ ├── IDataReaderWrapper.cs
│ │ │ ├── IDataSetFillLifecycleProcessor.cs
│ │ │ ├── IDbCommandCreator.cs
│ │ │ ├── IDbCommandCreatorFactory.cs
│ │ │ ├── IDbDataAdapterCreator.cs
│ │ │ ├── InvalidResultSetAccessException.cs
│ │ │ ├── IResultSetExtractor.cs
│ │ │ ├── IRowCallback.cs
│ │ │ ├── IRowMapper.cs
│ │ │ ├── Objects
│ │ │ │ ├── AbstractAdoOperation.cs
│ │ │ │ ├── AdoNonQuery.cs
│ │ │ │ ├── AdoOperation.cs
│ │ │ │ ├── AdoQuery.cs
│ │ │ │ ├── AdoScalar.cs
│ │ │ │ ├── Generic
│ │ │ │ │ ├── AdoOperation.cs
│ │ │ │ │ ├── AdoQuery.cs
│ │ │ │ │ ├── MappingAdoQuery.cs
│ │ │ │ │ ├── MappingAdoQueryWithContext.cs
│ │ │ │ │ └── StoredProcedure.cs
│ │ │ │ ├── MappingAdoQuery.cs
│ │ │ │ ├── MappingAdoQueryWithContext.cs
│ │ │ │ └── StoredProcedure.cs
│ │ │ ├── ResultSetExtractorDelegate.cs
│ │ │ ├── RowCallbackDelegate.cs
│ │ │ ├── RowMapperDelegate.cs
│ │ │ ├── Support
│ │ │ │ ├── AdoTransactionObjectSupport.cs
│ │ │ │ ├── AdoUtils.cs
│ │ │ │ ├── ConnectionHolder.cs
│ │ │ │ ├── ConnectionSynchronization.cs
│ │ │ │ ├── ConnectionTxPair.cs
│ │ │ │ ├── ConnectionUtils.cs
│ │ │ │ ├── DefaultServiceDomainAdapter.cs
│ │ │ │ ├── DefaultTransactionScopeAdapter.cs
│ │ │ │ ├── ErrorCodeExceptionTranslator.cs
│ │ │ │ ├── FallbackExceptionTranslator.cs
│ │ │ │ ├── IAdoExceptionTranslator.cs
│ │ │ │ ├── IServiceDomainAdapter.cs
│ │ │ │ ├── ITransactionScopeAdapter.cs
│ │ │ │ ├── NamedResultSetProcessor.cs
│ │ │ │ ├── NullMappingDataReader.cs
│ │ │ │ ├── ParameterUtils.cs
│ │ │ │ ├── RowCallbackResultSetExtractor.cs
│ │ │ │ ├── SimpleServiceConfig.cs
│ │ │ │ ├── Sql
│ │ │ │ │ └── sqlconnectionstring.xsd
│ │ │ │ └── TypedDataSetUtils.cs
│ │ │ └── UncategorizedAdoException.cs
│ │ ├── Spring.Data.2003.csproj
│ │ ├── Spring.Data.2005.csproj
│ │ ├── Spring.Data.2008.csproj
│ │ ├── Spring.Data.2010.csproj
│ │ ├── Spring.Data.build
│ │ ├── Spring.Data.nuspec
│ │ ├── Spring.Data.xml
│ │ └── Transaction
│ │ ├── CannotCreateTransactionException.cs
│ │ ├── Config
│ │ │ ├── AttributeDrivenObjectDefinitionParser.cs
│ │ │ ├── spring-tx-1.1.xsd
│ │ │ ├── TxAdviceObjectDefinitionParser.cs
│ │ │ ├── TxNamespaceParser.cs
│ │ │ └── TxNamespaceUtils.cs
│ │ ├── HeuristicCompletionException.cs
│ │ ├── IllegalTransactionStateException.cs
│ │ ├── Interceptor
│ │ │ ├── AbstractFallbackTransactionAttributeSource.cs
│ │ │ ├── AbstractTransactionAttributeSourcePointcut.cs
│ │ │ ├── AttributesTransactionAttributeSource.cs
│ │ │ ├── DefaultTransactionAttribute.cs
│ │ │ ├── DefaultTransactionAttributeSourceAdvisor.cs
│ │ │ ├── DelegatingTransactionAttributeWithName.cs
│ │ │ ├── ITransactionAttribute.cs
│ │ │ ├── ITransactionAttributeSource.cs
│ │ │ ├── MatchAlwaysTransactionAttributeSource.cs
│ │ │ ├── MethodMapTransactionAttributeSource.cs
│ │ │ ├── NameMatchTransactionAttributeSource.cs
│ │ │ ├── NoRollbackRuleAttribute.cs
│ │ │ ├── ObjectFactoryTransactionAttributeSourceAdvisor.cs
│ │ │ ├── RollbackRuleAttribute.cs
│ │ │ ├── RuleBasedTransactionAttribute.cs
│ │ │ ├── TransactionAspectSupport.cs
│ │ │ ├── TransactionAttributeConverter.cs
│ │ │ ├── TransactionAttribute.cs
│ │ │ ├── TransactionAttributeEditor.cs
│ │ │ ├── TransactionAttributeSourceAdvisor.cs
│ │ │ ├── TransactionAttributeSourceEditor.cs
│ │ │ ├── TransactionInterceptor.cs
│ │ │ └── TransactionProxyFactoryObject.cs
│ │ ├── InvalidIsolationLevelException.cs
│ │ ├── InvalidTimeoutException.cs
│ │ ├── IPlatformTransactionManager.cs
│ │ ├── ISavepointManager.cs
│ │ ├── ITransactionDefinition.cs
│ │ ├── ITransactionStatus.cs
│ │ ├── NestedTransactionNotSupportedException.cs
│ │ ├── NoTransactionException.cs
│ │ ├── Support
│ │ │ ├── AbstractPlatformTransactionManager.cs
│ │ │ ├── DefaultTransactionDefinition.cs
│ │ │ ├── DefaultTransactionStatus.cs
│ │ │ ├── IResourceTransactionManager.cs
│ │ │ ├── ISmartTransactionObject.cs
│ │ │ ├── ITransactionCallback.cs
│ │ │ ├── ITransactionOperations.cs
│ │ │ ├── ITransactionSynchronization.cs
│ │ │ ├── ResourceHolderSupport.cs
│ │ │ ├── TransactionCallbackWithoutResult.cs
│ │ │ ├── TransactionDelegate.cs
│ │ │ ├── TransactionSynchronizationAdapter.cs
│ │ │ ├── TransactionSynchronizationManager.cs
│ │ │ ├── TransactionSynchronizationState.cs
│ │ │ ├── TransactionSynchronizationStatus.cs
│ │ │ └── TransactionTemplate.cs
│ │ ├── TransactionException.cs
│ │ ├── TransactionOutcomeState.cs
│ │ ├── TransactionPropagation.cs
│ │ ├── TransactionSuspensionNotSupportedException.cs
│ │ ├── TransactionSystemException.cs
│ │ ├── TransactionTimedOutException.cs
│ │ ├── TransactionUsageException.cs
│ │ └── UnexpectedRollbackException.cs
│ ├── Spring.Data.NHibernate
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── HibernateAccessor.cs
│ │ │ ├── HibernateAdoException.cs
│ │ │ ├── HibernateDelegate.cs
│ │ │ ├── HibernateObjectRetrievalFailureException.cs
│ │ │ ├── HibernateOptimisticLockingFailureException.cs
│ │ │ ├── HibernateQueryException.cs
│ │ │ ├── HibernateSystemException.cs
│ │ │ ├── HibernateTemplate.cs
│ │ │ ├── HibernateTransactionManager.cs
│ │ │ ├── ICommonHibernateOperations.cs
│ │ │ ├── IHibernateCallback.cs
│ │ │ ├── IHibernateOperations.cs
│ │ │ ├── LocalSessionFactoryObject.cs
│ │ │ ├── SessionFactoryUtils.cs
│ │ │ ├── SessionHolder.cs
│ │ │ ├── SpringSessionSynchronization.cs
│ │ │ ├── Support
│ │ │ │ ├── ConfigSectionSessionScopeSettings.cs
│ │ │ │ ├── HibernateDaoSupport.cs
│ │ │ │ ├── OpenSessionInViewModule.cs
│ │ │ │ ├── SessionScope.cs
│ │ │ │ └── SessionScopeSettings.cs
│ │ │ └── TemplateFlushMode.cs
│ │ ├── Spring.Data.NHibernate.2003.csproj
│ │ ├── Spring.Data.NHibernate.2005.csproj
│ │ ├── Spring.Data.NHibernate.2008.csproj
│ │ └── Spring.Data.NHibernate.build
│ ├── Spring.Data.NHibernate12
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Generic
│ │ │ │ ├── FindHibernateDelegate.cs
│ │ │ │ ├── HibernateDaoSupport.cs
│ │ │ │ ├── HibernateDelegate.cs
│ │ │ │ ├── HibernateTemplate.cs
│ │ │ │ ├── IFindHibernateCallback.cs
│ │ │ │ ├── IHibernateCallback.cs
│ │ │ │ └── IHibernateOperations.cs
│ │ │ ├── HibernateAccessor.cs
│ │ │ ├── HibernateOptimisticLockingFailureException.cs
│ │ │ ├── LocalSessionFactoryObject.cs
│ │ │ ├── SessionFactoryUtils.cs
│ │ │ ├── SpringSessionContext.cs
│ │ │ ├── SpringSessionSynchronization.cs
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate12.2003.csproj
│ │ ├── Spring.Data.NHibernate12.2005.csproj
│ │ ├── Spring.Data.NHibernate12.2008.csproj
│ │ ├── Spring.Data.NHibernate12.2010.csproj
│ │ ├── Spring.Data.NHibernate12.build
│ │ ├── Spring.Data.NHibernate12.nuspec
│ │ └── Spring.Data.NHibernate12.xml
│ ├── Spring.Data.NHibernate20
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── FilterDefiniitionFactoryObject.cs
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ ├── HibernateObjectRetrievalFailureException.cs
│ │ │ ├── HibernateOptimisticLockingFailureException.cs
│ │ │ ├── LocalSessionFactoryObject.cs
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate20.2005.csproj
│ │ ├── Spring.Data.NHibernate20.2008.csproj
│ │ ├── Spring.Data.NHibernate20.2010.csproj
│ │ ├── Spring.Data.NHibernate20.build
│ │ ├── Spring.Data.NHibernate20.nuspec
│ │ └── Spring.Data.NHibernate20.xml
│ ├── Spring.Data.NHibernate21
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Bytecode
│ │ │ │ ├── BytecodeProvider.cs
│ │ │ │ ├── LazyInitializer.cs
│ │ │ │ ├── ObjectsFactory.cs
│ │ │ │ ├── ProxyFactory.cs
│ │ │ │ ├── ProxyFactoryFactory.cs
│ │ │ │ └── ReflectionOptimizer.cs
│ │ │ ├── DelegatingLocalSessionFactoryObject.cs
│ │ │ ├── DelegatingSessionFactory.cs
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ ├── HibernateTxScopeTransactionManager.cs
│ │ │ ├── SimpleDelegatingSessionFactory.cs
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate21.2005.csproj
│ │ ├── Spring.Data.NHibernate21.2008.csproj
│ │ ├── Spring.Data.NHibernate21.2010.csproj
│ │ ├── Spring.Data.NHibernate21.build
│ │ ├── Spring.Data.NHibernate21.nuspec
│ │ └── Spring.Data.NHibernate21.xml
│ ├── Spring.Data.NHibernate30
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Bytecode
│ │ │ │ └── dontdelete.txt
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate30.2008.csproj
│ │ ├── Spring.Data.NHibernate30.2010.csproj
│ │ ├── Spring.Data.NHibernate30.build
│ │ ├── Spring.Data.NHibernate30.nuspec
│ │ └── Spring.Data.NHibernate30.xml
│ ├── Spring.Data.NHibernate31
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Bytecode
│ │ │ │ └── dontdelete.txt
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate31.2008.csproj
│ │ ├── Spring.Data.NHibernate31.2010.csproj
│ │ ├── Spring.Data.NHibernate31.build
│ │ ├── Spring.Data.NHibernate31.nuspec
│ │ └── Spring.Data.NHibernate31.xml
│ ├── Spring.Data.NHibernate32
│ │ ├── AssemblyInfo.cs
│ │ ├── Data
│ │ │ └── NHibernate
│ │ │ ├── Bytecode
│ │ │ │ └── dontdelete.txt
│ │ │ ├── Generic
│ │ │ │ └── dontdelete.txt
│ │ │ └── Support
│ │ │ └── dontdelete.txt
│ │ ├── Spring.Data.NHibernate32.2008.csproj
│ │ ├── Spring.Data.NHibernate32.2010.csproj
│ │ ├── Spring.Data.NHibernate32.build
│ │ ├── Spring.Data.NHibernate32.nuspec
│ │ └── Spring.Data.NHibernate32.xml
│ ├── Spring.Messaging
│ │ ├── AssemblyInfo.cs
│ │ ├── Messaging
│ │ │ ├── Core
│ │ │ │ ├── DefaultMessageQueueFactory.cs
│ │ │ │ ├── IMessageQueueFactory.cs
│ │ │ │ ├── IMessageQueueOperations.cs
│ │ │ │ ├── LocallyExposedMessageQueueResourceHolder.cs
│ │ │ │ ├── MessagePostProcessorDelegate.cs
│ │ │ │ ├── MessageQueueGatewaySupport.cs
│ │ │ │ ├── MessageQueueMetadataCache.cs
│ │ │ │ ├── MessageQueueMetadata.cs
│ │ │ │ ├── MessageQueueResourceHolder.cs
│ │ │ │ ├── MessageQueueTemplate.cs
│ │ │ │ ├── MessageQueueTransactionManager.cs
│ │ │ │ └── QueueUtils.cs
│ │ │ ├── Listener
│ │ │ │ ├── AbstractListenerContainer.cs
│ │ │ │ ├── AbstractMessageListenerContainer.cs
│ │ │ │ ├── AbstractPeekingMessageListenerContainer.cs
│ │ │ │ ├── AbstractSendToQueueExceptionHandler.cs
│ │ │ │ ├── AbstractTransactionalMessageListenerContainer.cs
│ │ │ │ ├── DistributedTxMessageListenerContainer.cs
│ │ │ │ ├── IDistributedTransactionExceptionHandler.cs
│ │ │ │ ├── IExceptionHandler.cs
│ │ │ │ ├── IMessageListener.cs
│ │ │ │ ├── IMessageTransactionExceptionHandler.cs
│ │ │ │ ├── ListenerClassDiagram.cd
│ │ │ │ ├── ListenerExecutionFailedException.cs
│ │ │ │ ├── MessageListenerAdapter.cs
│ │ │ │ ├── NonTransactionalMessageListenerContainer.cs
│ │ │ │ ├── SendToQueueDistributedTransactionExceptionHandler.cs
│ │ │ │ ├── SendToQueueExceptionHandler.cs
│ │ │ │ ├── TransactionAction.cs
│ │ │ │ └── TransactionalMessageListenerContainer.cs
│ │ │ ├── MessagingException.cs
│ │ │ └── Support
│ │ │ ├── Converters
│ │ │ │ ├── ActiveXMessageConverter.cs
│ │ │ │ ├── BinaryMessageConverter.cs
│ │ │ │ ├── IMessageConverter.cs
│ │ │ │ ├── MessageConverterCreatorDelegate.cs
│ │ │ │ ├── MessageConverterFactoryObject.cs
│ │ │ │ ├── XmlDocumentConverter.cs
│ │ │ │ └── XmlMessageConverter.cs
│ │ │ ├── MessageQueueCreatorDelegate.cs
│ │ │ └── MessageQueueFactoryObject.cs
│ │ ├── Properties
│ │ ├── Spring.Messaging.2005.csproj
│ │ ├── Spring.Messaging.2008.csproj
│ │ ├── Spring.Messaging.2010.csproj
│ │ ├── Spring.Messaging.build
│ │ ├── Spring.Messaging.nuspec
│ │ └── Spring.Messaging.xml
│ ├── Spring.Messaging.Ems
│ │ ├── AssemblyInfo.cs
│ │ ├── Messaging
│ │ │ └── Ems
│ │ │ ├── Common
│ │ │ │ ├── EmsConnection.cs
│ │ │ │ ├── EmsConnectionFactory.cs
│ │ │ │ ├── EmsMessageConsumer.cs
│ │ │ │ ├── EmsMessageProducer.cs
│ │ │ │ ├── EmsSession.cs
│ │ │ │ ├── EmsSSLFileStoreInfo.cs
│ │ │ │ ├── EmsSSLSystemStoreInfo.cs
│ │ │ │ ├── EmsTopicSubscriber.cs
│ │ │ │ ├── IConnection.cs
│ │ │ │ ├── IConnectionFactory.cs
│ │ │ │ ├── IEmsSSLStoreType.cs
│ │ │ │ ├── IMessageConsumer.cs
│ │ │ │ ├── IMessageProducer.cs
│ │ │ │ ├── ISession.cs
│ │ │ │ └── ITopicSubscriber.cs
│ │ │ ├── Config
│ │ │ │ ├── EmsNamespaceParser.cs
│ │ │ │ ├── MessageListenerContainerObjectDefinitionParser.cs
│ │ │ │ └── spring-ems-1.3.xsd
│ │ │ ├── Connections
│ │ │ │ ├── CachedMessageConsumer .cs
│ │ │ │ ├── CachedMessageProducer.cs
│ │ │ │ ├── CachedSession.cs
│ │ │ │ ├── CachingConnectionFactory.cs
│ │ │ │ ├── ChainedExceptionListener.cs
│ │ │ │ ├── ConnectionFactoryUtils.cs
│ │ │ │ ├── EmsResourceHolder.cs
│ │ │ │ ├── EmsTransactionManager.cs
│ │ │ │ ├── IDecoratorSession.cs
│ │ │ │ ├── ISmartConnectionFactory.cs
│ │ │ │ ├── SingleConnectionFactory.cs
│ │ │ │ └── SynchedLocalTransactionFailedException.cs
│ │ │ ├── Core
│ │ │ │ ├── BrowserDelegate.cs
│ │ │ │ ├── EmsGatewaySupport.cs
│ │ │ │ ├── EmsTemplate.cs
│ │ │ │ ├── IBrowserCallback.cs
│ │ │ │ ├── IEmsOperations.cs
│ │ │ │ ├── IMessageCreator.cs
│ │ │ │ ├── IMessagePostProcessor.cs
│ │ │ │ ├── IProducerCallback.cs
│ │ │ │ ├── ISessionCallback.cs
│ │ │ │ ├── MessageCreatorDelegate.cs
│ │ │ │ ├── MessagePostProcessorDelegate.cs
│ │ │ │ ├── ProducerDelegate.cs
│ │ │ │ └── SessionDelegate.cs
│ │ │ ├── Jndi
│ │ │ │ ├── JndiAccessor.cs
│ │ │ │ ├── JndiContextType.cs
│ │ │ │ ├── JndiLocatorSupport.cs
│ │ │ │ ├── JndiLookupFactoryObject.cs
│ │ │ │ ├── JndiObjectLocator.cs
│ │ │ │ ├── LookupContextFactoryObject.cs
│ │ │ │ └── TypeMismatchNamingException.cs
│ │ │ ├── Listener
│ │ │ │ ├── AbstractListenerContainer.cs
│ │ │ │ ├── AbstractMessageListenerContainer.cs
│ │ │ │ ├── Adapter
│ │ │ │ │ ├── ListenerExecutionFailedException.cs
│ │ │ │ │ └── MessageListenerAdapter.cs
│ │ │ │ ├── ISessionAwareMessageListener.cs
│ │ │ │ ├── LocallyExposedEmsResourceHolder.cs
│ │ │ │ ├── RecoveryTimeExceededException.cs
│ │ │ │ └── SimpleMessageListenerContainer.cs
│ │ │ └── Support
│ │ │ ├── Converter
│ │ │ │ ├── IMessageConverter.cs
│ │ │ │ ├── ITypeMapper.cs
│ │ │ │ ├── MessageConversionException.cs
│ │ │ │ ├── SimpleMessageConverter.cs
│ │ │ │ ├── TypeMapper.cs
│ │ │ │ └── XmlMessageConverter.cs
│ │ │ ├── Destinations
│ │ │ │ ├── DynamicDestinationResolver.cs
│ │ │ │ ├── EmsDestinationAccessor.cs
│ │ │ │ └── IDestinationResolver.cs
│ │ │ ├── EmsAccessor.cs
│ │ │ └── EmsUtils.cs
│ │ ├── Spring.Messaging.Ems.2005.csproj
│ │ ├── Spring.Messaging.Ems.2008.csproj
│ │ ├── Spring.Messaging.Ems.2010.csproj
│ │ ├── Spring.Messaging.Ems.build
│ │ ├── Spring.Messaging.Ems.nuspec
│ │ └── Spring.Messaging.Ems.xml
│ ├── Spring.Messaging.Nms
│ │ ├── AssemblyInfo.cs
│ │ ├── Messaging
│ │ │ └── Nms
│ │ │ ├── Config
│ │ │ │ ├── MessageListenerContainerObjectDefinitionParser.cs
│ │ │ │ ├── NmsNamespaceParser.cs
│ │ │ │ ├── spring-nms-1.2.xsd
│ │ │ │ └── spring-nms-1.3.xsd
│ │ │ ├── Connections
│ │ │ │ ├── CachedMessageConsumer .cs
│ │ │ │ ├── CachedMessageProducer.cs
│ │ │ │ ├── CachedSession.cs
│ │ │ │ ├── CachingConnectionFactory.cs
│ │ │ │ ├── ChainedExceptionListener.cs
│ │ │ │ ├── ConnectionFactoryUtils.cs
│ │ │ │ ├── IDecoratorSession.cs
│ │ │ │ ├── ISmartConnectionFactory.cs
│ │ │ │ ├── NmsResourceHolder.cs
│ │ │ │ ├── NmsTransactionManager.cs
│ │ │ │ ├── SingleConnectionFactory.cs
│ │ │ │ └── SynchedLocalTransactionFailedException.cs
│ │ │ ├── Core
│ │ │ │ ├── IExceptionListener.cs
│ │ │ │ ├── IMessageCreator.cs
│ │ │ │ ├── IMessageListener.cs
│ │ │ │ ├── IMessagePostProcessor.cs
│ │ │ │ ├── INmsOperations.cs
│ │ │ │ ├── IProducerCallback.cs
│ │ │ │ ├── ISessionCallback.cs
│ │ │ │ ├── MessageCreatorDelegate.cs
│ │ │ │ ├── MessagePostProcessorDelegate.cs
│ │ │ │ ├── NmsGatewaySupport.cs
│ │ │ │ ├── NmsTemplate.cs
│ │ │ │ ├── NmsTrace.cs
│ │ │ │ ├── ProducerDelegate.cs
│ │ │ │ └── SessionDelegate.cs
│ │ │ ├── Listener
│ │ │ │ ├── AbstractListenerContainer.cs
│ │ │ │ ├── AbstractMessageListenerContainer.cs
│ │ │ │ ├── Adapter
│ │ │ │ │ ├── ListenerExecutionFailedException.cs
│ │ │ │ │ └── MessageListenerAdapter.cs
│ │ │ │ ├── ISessionAwareMessageListener.cs
│ │ │ │ ├── LocallyExposedNmsResourceHolder.cs
│ │ │ │ ├── RecoveryTimeExceededException.cs
│ │ │ │ └── SimpleMessageListenerContainer.cs
│ │ │ └── Support
│ │ │ ├── Converter
│ │ │ │ ├── IMessageConverter.cs
│ │ │ │ ├── ITypeMapper.cs
│ │ │ │ ├── MessageConversionException.cs
│ │ │ │ ├── SimpleMessageConverter.cs
│ │ │ │ ├── TypeMapper.cs
│ │ │ │ └── XmlMessageConverter.cs
│ │ │ ├── Destinations
│ │ │ │ ├── DynamicDestinationResolver.cs
│ │ │ │ ├── IDestinationResolver.cs
│ │ │ │ └── NmsDestinationAccessor.cs
│ │ │ ├── MessageUtils.cs
│ │ │ └── NmsAccessor.cs
│ │ ├── Properties
│ │ ├── Spring.Messaging.Nms.2003.csproj
│ │ ├── Spring.Messaging.Nms.2005.csproj
│ │ ├── Spring.Messaging.Nms.2008.csproj
│ │ ├── Spring.Messaging.Nms.2010.csproj
│ │ ├── Spring.Messaging.Nms.build
│ │ ├── Spring.Messaging.Nms.nuspec
│ │ └── Spring.Messaging.Nms.xml
│ ├── Spring.Scheduling.Quartz
│ │ ├── JobMethodInvocationFailedException.cs
│ │ ├── Scheduling
│ │ │ └── Quartz
│ │ │ ├── AdaptableJobFactory.cs
│ │ │ ├── CronTriggerObject.cs
│ │ │ ├── DelegatingJob.cs
│ │ │ ├── IJobDetailAwareTrigger.cs
│ │ │ ├── ISchedulerContextAware.cs
│ │ │ ├── ISchedulingTaskExecutor.cs
│ │ │ ├── ITaskExecutor.cs
│ │ │ ├── JobDetailObject.cs
│ │ │ ├── LocalDataSourceJobStore.cs
│ │ │ ├── LocalTaskExecutorThreadPool.cs
│ │ │ ├── MethodInvokingJob.cs
│ │ │ ├── MethodInvokingJobDetailFactoryObject.cs
│ │ │ ├── MethodInvokingRunnable.cs
│ │ │ ├── QuartzJobObject.cs
│ │ │ ├── ResourceJobSchedulingDataProcessor.cs
│ │ │ ├── SchedulerAccessor.cs
│ │ │ ├── SchedulerAccessorObject.cs
│ │ │ ├── SchedulerFactoryObject.cs
│ │ │ ├── SchedulingException.cs
│ │ │ ├── SimpleThreadPoolTaskExecutor.cs
│ │ │ ├── SimpleTriggerObject.cs
│ │ │ ├── SpringDbProviderAdapter.cs
│ │ │ ├── SpringObjectJobFactory.cs
│ │ │ ├── StatefulMethodInvokingJob.cs
│ │ │ └── TaskRejectedException.cs
│ │ ├── Spring.Scheduling.Quartz.2003.csproj
│ │ ├── Spring.Scheduling.Quartz.2005.csproj
│ │ ├── Spring.Scheduling.Quartz.2008.csproj
│ │ ├── Spring.Scheduling.Quartz.2010.csproj
│ │ ├── Spring.Scheduling.Quartz.build
│ │ └── Spring.Scheduling.Quartz.nuspec
│ ├── Spring.Services
│ │ ├── AssemblyInfo.cs
│ │ ├── EnterpriseServices
│ │ │ ├── EnterpriseServicesExporter.cs
│ │ │ ├── EnterpriseServices.keys
│ │ │ ├── ExeConfigurationSystem.cs
│ │ │ ├── ServicedComponentContextHandler.cs
│ │ │ ├── ServicedComponentExporter.cs
│ │ │ ├── ServicedComponentFactory.cs
│ │ │ └── ServicedComponentHelper.cs
│ │ ├── Remoting
│ │ │ ├── CaoExporter.cs
│ │ │ ├── CaoFactoryObject.cs
│ │ │ ├── Config
│ │ │ │ ├── RemotingNamespaceParser.cs
│ │ │ │ ├── spring-remoting-1.1.xsd
│ │ │ │ └── spring-remoting-1.1.xsx
│ │ │ ├── RemoteObjectFactory.cs
│ │ │ ├── RemotingConfigurer.cs
│ │ │ ├── SaoExporter.cs
│ │ │ ├── SaoFactoryObject.cs
│ │ │ └── Support
│ │ │ ├── BaseRemoteObject.cs
│ │ │ ├── ConfigurableLifetime.cs
│ │ │ ├── ICaoRemoteFactory.cs
│ │ │ ├── ILifetime.cs
│ │ │ └── RemoteObjectProxyTypeBuilder.cs
│ │ ├── ServiceModel
│ │ │ ├── Activation
│ │ │ │ ├── ServiceHostFactory.cs
│ │ │ │ ├── ServiceHostFactoryObject.cs
│ │ │ │ └── WebServiceHostFactory.cs
│ │ │ ├── ChannelFactoryObject.cs
│ │ │ ├── Config
│ │ │ │ ├── ChannelFactoryObjectDefinitionParser.cs
│ │ │ │ ├── spring-wcf-1.3.xsd
│ │ │ │ └── WcfNamespaceParser.cs
│ │ │ ├── ServiceExporter.cs
│ │ │ ├── SpringServiceHost.cs
│ │ │ ├── SpringWebServiceHost.cs
│ │ │ └── Support
│ │ │ └── ServiceProxyTypeBuilder.cs
│ │ ├── Spring.Services.2003.csproj
│ │ ├── Spring.Services.2005.csproj
│ │ ├── Spring.Services.2008.csproj
│ │ ├── Spring.Services.2010.csproj
│ │ ├── Spring.Services.build
│ │ ├── Spring.Services.nuspec
│ │ ├── Spring.Services.xml
│ │ └── Web
│ │ └── Services
│ │ └── WebServiceProxyFactory.cs
│ ├── Spring.Template.Velocity
│ │ ├── Spring.Template.Velocity.2008.csproj
│ │ ├── Spring.Template.Velocity.2010.csproj
│ │ ├── Spring.Template.Velocity.build
│ │ ├── Spring.Template.Velocity.nuspec
│ │ └── Template
│ │ └── Velocity
│ │ ├── CommonsLoggingLogSystem.cs
│ │ ├── Config
│ │ │ ├── spring-nvelocity-1.3.xsd
│ │ │ └── TemplateNamespaceParser.cs
│ │ ├── SpringResourceLoader.cs
│ │ ├── VelocityConstants.cs
│ │ ├── VelocityEngineFactory.cs
│ │ ├── VelocityEngineFactoryObject.cs
│ │ └── VelocityEngineUtils.cs
│ ├── Spring.Testing.Microsoft
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.Testing.Microsoft.2008.csproj
│ │ ├── Spring.Testing.Microsoft.2010.csproj
│ │ ├── Spring.Testing.Microsoft.build
│ │ ├── Spring.Testing.Microsoft.nuspec
│ │ └── Testing
│ │ └── Microsoft
│ │ ├── AbstractDependencyInjectionSpringContextTests.cs
│ │ ├── AbstractSpringContextTests.cs
│ │ ├── AbstractTransactionalDbProviderSpringContextTests.cs
│ │ └── AbstractTransactionalSpringContextTests.cs
│ ├── Spring.Testing.NUnit
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.Testing.NUnit.2003.csproj
│ │ ├── Spring.Testing.NUnit.2005.csproj
│ │ ├── Spring.Testing.NUnit.2008.csproj
│ │ ├── Spring.Testing.NUnit.2010.csproj
│ │ ├── Spring.Testing.NUnit.build
│ │ ├── Spring.Testing.NUnit.nuspec
│ │ ├── Spring.Testing.NUnit.xml
│ │ └── Testing
│ │ ├── Ado
│ │ │ ├── IPlatformTransaction.cs
│ │ │ └── SimpleAdoTestUtils.cs
│ │ └── NUnit
│ │ ├── AbstractDependencyInjectionSpringContextTests.cs
│ │ ├── AbstractSpringContextTests.cs
│ │ ├── AbstractTransactionalDbProviderSpringContextTests.cs
│ │ └── AbstractTransactionalSpringContextTests.cs
│ ├── Spring.Web
│ │ ├── AssemblyInfo.cs
│ │ ├── Caching
│ │ │ └── AspNetCache.cs
│ │ ├── Context
│ │ │ └── Support
│ │ │ ├── HttpApplicationConfigurer.cs
│ │ │ ├── WebApplicationContextArgs.cs
│ │ │ ├── WebApplicationContext.cs
│ │ │ ├── WebContextHandler.cs
│ │ │ └── WebSupportModule.cs
│ │ ├── Core
│ │ │ └── IO
│ │ │ └── WebResource.cs
│ │ ├── DataBinding
│ │ │ ├── DataSourceItemFormatter.cs
│ │ │ ├── HttpRequestBindingContainer.cs
│ │ │ ├── IBindingAwareFormatter.cs
│ │ │ ├── IWebDataBound.cs
│ │ │ └── MultipleSelectionListControlBinding.cs
│ │ ├── Globalization
│ │ │ ├── AspNetResourceCache.cs
│ │ │ └── Resolvers
│ │ │ ├── CookieCultureResolver.cs
│ │ │ ├── DefaultWebCultureResolver.cs
│ │ │ ├── RequestCultureResolver.cs
│ │ │ └── SessionCultureResolver.cs
│ │ ├── Objects
│ │ │ └── Factory
│ │ │ ├── Support
│ │ │ │ ├── ChildWebObjectDefinition.cs
│ │ │ │ ├── IWebObjectDefinition.cs
│ │ │ │ ├── IWebObjectNameGenerator.cs
│ │ │ │ ├── RootWebObjectDefinition.cs
│ │ │ │ ├── WebInstantiationStrategy.cs
│ │ │ │ ├── WebObjectDefinitionFactory.cs
│ │ │ │ ├── WebObjectFactory.cs
│ │ │ │ └── WebObjectUtils.cs
│ │ │ └── Xml
│ │ │ ├── WebObjectDefinitionDocumentReader.cs
│ │ │ ├── WebObjectDefinitionParserHelper.cs
│ │ │ ├── WebObjectDefinitionReader.cs
│ │ │ └── WebObjectsNamespaceParser.cs
│ │ ├── Spring.Web.2003.csproj
│ │ ├── Spring.Web.2005.csproj
│ │ ├── Spring.Web.2008.csproj
│ │ ├── Spring.Web.2010.csproj
│ │ ├── Spring.Web.build
│ │ ├── Spring.Web.nuspec
│ │ ├── Spring.Web.xml
│ │ ├── Threading
│ │ │ ├── HttpContextStorage.cs
│ │ │ └── HybridContextStorage.cs
│ │ ├── Util
│ │ │ ├── HttpContextSwitch.cs
│ │ │ ├── ISessionState.cs
│ │ │ ├── IVirtualEnvironment.cs
│ │ │ ├── SecurityCritical.cs
│ │ │ ├── VirtualEnvironment.cs
│ │ │ └── WebUtils.cs
│ │ └── Web
│ │ ├── Providers
│ │ │ ├── ConfigurableActiveDirectoryMembershipProvider.cs
│ │ │ ├── ConfigurableSqlMembershipProvider.cs
│ │ │ ├── ConfigurableSqlProfileProvider.cs
│ │ │ ├── ConfigurableSqlRoleProvider.cs
│ │ │ ├── ConfigurableXmlSiteMapProvider.cs
│ │ │ ├── IMembershipProvider.cs
│ │ │ ├── IProfileProvider.cs
│ │ │ ├── IRoleProvider.cs
│ │ │ ├── ISiteMapProvider.cs
│ │ │ ├── MembershipProviderAdapter.cs
│ │ │ ├── ProfileProviderAdapter.cs
│ │ │ ├── RoleProviderAdapter.cs
│ │ │ └── SiteMapProviderAdapter.cs
│ │ ├── Services
│ │ │ ├── WebServiceExporter.cs
│ │ │ └── WebServiceHandlerFactory.cs
│ │ ├── Support
│ │ │ ├── AbstractHandlerFactory.cs
│ │ │ ├── ContextMonitor.cs
│ │ │ ├── ControlAccessor.cs
│ │ │ ├── ControlCollectionAccessor.cs
│ │ │ ├── ControlInterceptor.cs
│ │ │ ├── DefaultHandlerFactory.cs
│ │ │ ├── DefaultResultFactory.cs
│ │ │ ├── DefaultResultWebNavigator.cs
│ │ │ ├── HandlerMap.cs
│ │ │ ├── HandlerMapEntry.cs
│ │ │ ├── IHierarchicalWebNavigator.cs
│ │ │ ├── IInterceptionStrategy.cs
│ │ │ ├── InterceptControlCollectionOwnerStrategy.cs
│ │ │ ├── InterceptControlCollectionStrategy.cs
│ │ │ ├── IResult.cs
│ │ │ ├── IResultFactory.cs
│ │ │ ├── IResultWebNavigator.cs
│ │ │ ├── ISupportsWebDependencyInjection.cs
│ │ │ ├── IWebNavigable.cs
│ │ │ ├── IWebNavigator.cs
│ │ │ ├── LocalResourceManager.cs
│ │ │ ├── MappingHandlerFactoryConfigurer.cs
│ │ │ ├── MappingHandlerFactory.cs
│ │ │ ├── MimeMediaType.cs
│ │ │ ├── PageHandlerFactory.cs
│ │ │ ├── Result.cs
│ │ │ ├── ResultFactoryRegistry.cs
│ │ │ ├── ResultMode.cs
│ │ │ ├── Script.cs
│ │ │ ├── SharedStateResourceCache.cs
│ │ │ ├── SupportsWebDependencyInjectionMethodBuilder.cs
│ │ │ ├── SupportsWebDependencyInjectionOwnerProxy.cs
│ │ │ ├── SupportsWebDependencyInjectionTypeBuilder.cs
│ │ │ ├── WebDependencyInjectionUtils.cs
│ │ │ ├── WebFormsResultWebNavigator.cs
│ │ │ └── WebNavigableWebNavigatorAdapter.cs
│ │ └── UI
│ │ ├── AbstractWizard.cs
│ │ ├── Controls
│ │ │ ├── AbstractBaseValidator.cs
│ │ │ ├── AbstractValidationControl.cs
│ │ │ ├── Calendar.cs
│ │ │ ├── CheckBoxList.cs
│ │ │ ├── CheckBoxValidator.cs
│ │ │ ├── Content.cs
│ │ │ ├── ContentPlaceholder.cs
│ │ │ ├── ContentReplacer.cs
│ │ │ ├── ControlState.cs
│ │ │ ├── DataBindingAdapter.cs
│ │ │ ├── DataBindingPanel.cs
│ │ │ ├── Form.cs
│ │ │ ├── Head.cs
│ │ │ ├── LocalizedImage.cs
│ │ │ ├── MultiView.cs
│ │ │ ├── Panel.cs
│ │ │ ├── RadioButtonGroup.cs
│ │ │ ├── TabCommandEventArgs.cs
│ │ │ ├── TabCommandEventHandler.cs
│ │ │ ├── TabContainer.cs
│ │ │ ├── TabularMultiView.cs
│ │ │ ├── TabularViewCollection.cs
│ │ │ ├── TabularView.cs
│ │ │ ├── ValidationError.cs
│ │ │ ├── ValidationSummary.cs
│ │ │ ├── ViewCollection.cs
│ │ │ └── View.cs
│ │ ├── DialogAttribute.cs
│ │ ├── IModelPersistenceMedium.cs
│ │ ├── IValidationContainer.cs
│ │ ├── MasterPage.cs
│ │ ├── Page.cs
│ │ ├── SessionModelPersistenceMedium.cs
│ │ ├── UserControl.cs
│ │ └── Validation
│ │ ├── AbstractValidationErrorsRenderer.cs
│ │ ├── DivValidationErrorsRenderer.cs
│ │ ├── IconValidationErrorsRenderer.cs
│ │ ├── IValidationErrorsRenderer.cs
│ │ └── SpanValidationErrorsRenderer.cs
│ ├── Spring.Web.Extensions
│ │ ├── AssemblyInfo.cs
│ │ ├── Spring.Web.Extensions.2005.csproj
│ │ ├── Spring.Web.Extensions.2008.csproj
│ │ ├── Spring.Web.Extensions.2010.csproj
│ │ ├── Spring.Web.Extensions.build
│ │ ├── Spring.Web.Extensions.nuspec
│ │ ├── Spring.Web.Extensions.xml
│ │ └── Web
│ │ └── Script
│ │ └── Services
│ │ └── ScriptHandlerFactory.cs
│ ├── Spring.Web.Mvc
│ │ ├── Context
│ │ │ └── Support
│ │ │ ├── MvcApplicationContextArgs.cs
│ │ │ ├── MvcApplicationContext.cs
│ │ │ └── MvcContextHandler.cs
│ │ ├── Properties
│ │ ├── SpringActionInvoker.cs
│ │ ├── SpringControllerFactory.cs
│ │ ├── SpringMvcApplication.cs
│ │ ├── Spring.Web.Mvc.2010.csproj
│ │ ├── Spring.Web.Mvc.build
│ │ ├── Spring.Web.Mvc.nuspec
│ │ └── Spring.Web.Mvc.xml
│ └── Spring.Web.Mvc3
│ ├── Context
│ │ └── Support
│ │ ├── MvcApplicationContextArgs.cs
│ │ ├── MvcApplicationContext.cs
│ │ └── MvcContextHandler.cs
│ ├── Properties
│ ├── SpringMvcApplication.cs
│ ├── SpringMvcDependencyResolver.cs
│ ├── Spring.Web.Mvc3.2010.csproj
│ ├── Spring.Web.Mvc3.build
│ ├── Spring.Web.Mvc3.nuspec
│ └── Spring.Web.Mvc3.xml
└── test
└── Spring
├── CommonAssemblyInfo.cs
├── Spring.Aop.Tests
│ ├── Aop
│ │ ├── Advice
│ │ │ └── DebugAdvice.cs
│ │ ├── Config
│ │ │ ├── AopNamespaceParserTests.cs
│ │ │ └── AopNamespaceParserTests.xml
│ │ ├── Framework
│ │ │ ├── AbstractMethodInvocationTests.cs
│ │ │ ├── Adapter
│ │ │ │ ├── AdvisorAdapterRegistrationTests.cs
│ │ │ │ ├── AfterReturningAdviceInterceptorTests.cs
│ │ │ │ ├── ThrowsAdviceInterceptorTests.cs
│ │ │ │ └── UnknownAdviceTypeExceptionTests.cs
│ │ │ ├── AopContextTests.cs
│ │ │ ├── AutoProxy
│ │ │ │ ├── AbstractAdvisorAutoProxyCreatorTests.cs
│ │ │ │ ├── AbstractAutoProxyCreatorTests.cs
│ │ │ │ ├── AdvisorAutoProxyCreatorCircularReferencesTests.cs
│ │ │ │ ├── advisorAutoProxyCreatorCircularReferencesTests.xml
│ │ │ │ ├── AdvisorAutoProxyCreatorTests.cs
│ │ │ │ ├── AttributeAutoProxyCreatorTests.cs
│ │ │ │ ├── CreatesTestObject.cs
│ │ │ │ ├── DefaultAdvisorAutoProxyCreatorTests.cs
│ │ │ │ ├── InfrastructureAdvisorAutoProxyCreator.cs
│ │ │ │ ├── LogicalThreadContextAdvice.cs
│ │ │ │ ├── NoSetterProperties.cs
│ │ │ │ ├── ObjectNameAutoProxyCreatorTests.cs
│ │ │ │ ├── OrderedLogicalThreadContextCheckAdvisor.cs
│ │ │ │ ├── PointcutFilteringAutoProxyCreatorTests.cs
│ │ │ │ └── TypeNameAutoProxyCreatorTests.cs
│ │ │ ├── CountingAfterReturningAdvice.cs
│ │ │ ├── CountingBeforeAdvice.cs
│ │ │ ├── CountingMultiAdvice.cs
│ │ │ ├── CountingThrowsAdvice.cs
│ │ │ ├── DynamicMethodInvocationTests.cs
│ │ │ ├── DynamicProxy
│ │ │ │ ├── AbstractAopProxyTests.cs
│ │ │ │ ├── AopUtilsTests.cs
│ │ │ │ ├── CachedAopProxyFactoryTests.cs
│ │ │ │ ├── CompositionAopProxyTests.cs
│ │ │ │ ├── DecoratorAopProxyTests.cs
│ │ │ │ ├── DefaultAopProxyFactoryTests.cs
│ │ │ │ ├── InheritanceAopProxyTests.cs
│ │ │ │ └── MockTargetSource.cs
│ │ │ ├── HashtableCachingAdvisorChainFactoryTests.cs
│ │ │ ├── IIsModified.cs
│ │ │ ├── IsModifiedMixin.cs
│ │ │ ├── ITimeStamped.cs
│ │ │ ├── MethodCounter.cs
│ │ │ ├── PrototypeTargetTests.cs
│ │ │ ├── ProxyConfigTests.cs
│ │ │ ├── ProxyFactoryObjectTests.cs
│ │ │ ├── ProxyFactoryTests.cs
│ │ │ ├── ReflectiveMethodInvocationTests.cs
│ │ │ ├── TimestampIntroductionInterceptor.cs
│ │ │ └── UnsupportedInterceptor.cs
│ │ ├── Interceptor
│ │ │ ├── NopInterceptor.cs
│ │ │ └── SerializableNopInterceptor.cs
│ │ ├── ISimpleBeforeAdvice.cs
│ │ ├── SimpleBeforeAdviceAdapter.cs
│ │ ├── SimpleBeforeAdviceImpl.cs
│ │ ├── SimpleBeforeAdviceInterceptor.cs
│ │ ├── Support
│ │ │ ├── AbstractRegularExpressionMethodPointcutTests.cs
│ │ │ ├── AttributeMatchMethodPointcutTests.cs
│ │ │ ├── ControlFlowPointcutTests.cs
│ │ │ ├── DefaultIntroductionAdvisorTests.cs
│ │ │ ├── DelegatingIntroductionInterceptorTests.cs
│ │ │ ├── RegularExpressionMethodPointcutAdvisorTests.cs
│ │ │ ├── RootTypeFilterTests.cs
│ │ │ ├── SdkRegularExpressionMethodPointcutTests.cs
│ │ │ └── TypeFiltersTests.cs
│ │ ├── Target
│ │ │ ├── EmptyTargetSourceTests.cs
│ │ │ ├── HotSwappableTargetSourceTests.cs
│ │ │ ├── PrototypeTargetSourceTests.cs
│ │ │ ├── SimplePoolTargetSourceTests.cs
│ │ │ ├── SingletonTargetSourceTests.cs
│ │ │ └── ThreadLocalTargetSourceTests.cs
│ │ ├── TrueMethodMatcherTests.cs
│ │ ├── TruePointcutTests.cs
│ │ └── TrueTypeFilterTests.cs
│ ├── AopCompilerOptionsTests.cs
│ ├── AopExceptionTests.cs
│ ├── AopSerializationTests.cs
│ ├── Aspects
│ │ ├── Cache
│ │ │ ├── CacheAspectIntegrationTests.cs
│ │ │ ├── CacheParameterAdviceTests.cs
│ │ │ ├── CacheResultAdviceTests.cs
│ │ │ └── InvalidateCacheAdviceTests.cs
│ │ ├── Exception
│ │ │ ├── CaptureOutputLogger.cs
│ │ │ ├── CaptureOutputLoggerFactoryAdapter.cs
│ │ │ └── ExceptionHandlerAspectIntegrationTests.cs
│ │ ├── Logging
│ │ │ ├── SimpleLoggingAdviceTests.cs
│ │ │ └── TestableSimpleLoggingAdvice.cs
│ │ ├── RetryAdviceTests.cs
│ │ └── Validation
│ │ └── ParameterValidationAdviceTests.cs
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── Spring
│ │ └── Aop
│ │ ├── Framework
│ │ │ ├── adapter
│ │ │ │ ├── withBPPContext.xml
│ │ │ │ └── withoutBPPContext.xml
│ │ │ ├── AutoProxy
│ │ │ │ ├── advisorAutoProxyCreator.xml
│ │ │ │ └── objectNameAutoProxyCreatorTests.xml
│ │ │ ├── innerBeanTarget.xml
│ │ │ ├── prototypeTarget.xml
│ │ │ ├── prototypeTests.xml
│ │ │ ├── proxyFactoryDoubleTargetSourceTests.xml
│ │ │ ├── proxyFactoryTargetSourceTests.xml
│ │ │ ├── proxyFactoryTests.xml
│ │ │ ├── serializationTests.xml
│ │ │ └── throwsAdvice.xml
│ │ ├── Support
│ │ │ └── RegularExpressionSetterTests.xml
│ │ └── Target
│ │ ├── commonsPoolTests.xml
│ │ ├── hotSwapTests.xml
│ │ ├── prototypeTargetSourceTests.xml
│ │ ├── simplePoolTests.xml
│ │ └── threadLocalTests.xml
│ ├── Spring.Aop.Tests.2002.csproj
│ ├── Spring.Aop.Tests.2003.csproj
│ ├── Spring.Aop.Tests.2005.csproj
│ ├── Spring.Aop.Tests.2008.csproj
│ ├── Spring.Aop.Tests.2010.csproj
│ ├── Spring.Aop.Tests.build
│ └── Spring.Aop.Tests.dll.config
├── Spring.Core.Tests
│ ├── AssemblyInfo.cs
│ ├── Caching
│ │ ├── AbstractCacheTests.cs
│ │ └── BaseCacheAttributeTests.cs
│ ├── Collections
│ │ ├── AbstractQueueTests.cs
│ │ ├── CaseInsensitiveHashtableTests.cs
│ │ ├── Generic
│ │ │ └── ReadOnlyDictionaryTests.cs
│ │ ├── HashedSetTests.cs
│ │ ├── HybridSetTests.cs
│ │ ├── ImmutableSetTests.cs
│ │ ├── LinkedListTests.cs
│ │ ├── ListSetTests.cs
│ │ ├── PriorityQueueTests.cs
│ │ ├── SetTests.cs
│ │ ├── SortedSetTests.cs
│ │ ├── StaticSetTests.cs
│ │ └── SynchronizedHashtableTests.cs
│ ├── CommonTypes.cs
│ ├── CompilerOptionsTests.cs
│ ├── Context
│ │ ├── ApplicationEventArgsTests.cs
│ │ ├── CommonTypes.cs
│ │ ├── ContextExceptionTests.cs
│ │ ├── contextlifecycle.xml
│ │ ├── ContextListenerObject.cs
│ │ ├── EventListenerAttributeTests.cs
│ │ ├── Events
│ │ │ └── ConsoleListenerTests.cs
│ │ └── Support
│ │ ├── AbstractApplicationContextTests.cs
│ │ ├── AbstractMessageSourceTests.cs
│ │ ├── ApplicationContextAwareProcessorTests.cs
│ │ ├── ApplicationContextExtensionTests.cs
│ │ ├── ApplicationObjectSupportTests.cs
│ │ ├── Assembler.cs
│ │ ├── contextA.xml
│ │ ├── contextB.xml
│ │ ├── contextC.xml
│ │ ├── ContextLocatorHandlerTests.cs
│ │ ├── ContextRegistryTests.cs
│ │ ├── DefaultMessageSourceResolvableTests.cs
│ │ ├── DelegatingMessageSourceTests.cs
│ │ ├── import1.xml
│ │ ├── innerObjectsWithPostProcessor.xml
│ │ ├── invalidType.xml
│ │ ├── invalidValueType.xml
│ │ ├── Logic.cs
│ │ ├── MessageSourceAccessorTests.cs
│ │ ├── NamespaceParsersSectionHandlerTests.cs
│ │ ├── NullMessageSourceTests.cs
│ │ ├── objects.xml
│ │ ├── ResourceSetMessageSourceTests.cs
│ │ ├── Service.cs
│ │ ├── simpleContext.xml
│ │ ├── StaticApplicationContextTests.cs
│ │ ├── StaticMessageSourceTests.cs
│ │ ├── TestObjectConfigParser.cs
│ │ ├── testobject.xsd
│ │ ├── testobject.xsx
│ │ ├── TypeAliasesSectionHandlerTests.cs
│ │ ├── XmlApplicationContentArgsTests.cs
│ │ ├── XmlApplicationContextTests.cs
│ │ └── XmlApplicationContextTests-SPRNET1231.xml
│ ├── Core
│ │ ├── ComposedCriteriaTests.cs
│ │ ├── ControlFlowFactoryTests.cs
│ │ ├── IO
│ │ │ ├── AssemblyResourceTest.cs
│ │ │ ├── ConfigSectionResourceTests_config1.xml
│ │ │ ├── ConfigSectionResourceTests.cs
│ │ │ ├── ConfigurableResourceLoaderTests.cs
│ │ │ ├── EncodedResourceTests.cs
│ │ │ ├── FileSystemResourceCommonTests.cs
│ │ │ ├── FileSystemResourceTests.cs
│ │ │ ├── InputStreamResourceTests.cs
│ │ │ ├── ResourceConverterTests.cs
│ │ │ ├── ResourceHandlerRegistryTests.cs
│ │ │ ├── StringResourceTests.cs
│ │ │ ├── TestResource.txt
│ │ │ └── UrlResourceTest.cs
│ │ ├── MethodArgumentsCriteriaTests.cs
│ │ ├── MethodGenericArgumentsCountCriteriaTests.cs
│ │ ├── MethodParametersCountCriteriaTests.cs
│ │ ├── MethodParametersCriteriaTests.cs
│ │ ├── MethodReturnTypeCriteriaTests.cs
│ │ ├── OrderComparatorTests.cs
│ │ ├── RegularExpressionEventNameCriteriaTests.cs
│ │ ├── RegularExpressionMethodNameCriteriaTests.cs
│ │ ├── TypeConversion
│ │ │ ├── CredentialConverterTests.cs
│ │ │ ├── CustomNumberConverterTests.cs
│ │ │ ├── FileInfoConverterTests.cs
│ │ │ ├── NameValueConverterTests.cs
│ │ │ ├── RegexConverterTests.cs
│ │ │ ├── RegistryKeyConverterTests.cs
│ │ │ ├── ResourceManagerTests.cs
│ │ │ ├── RGBColorConverterTests.cs
│ │ │ ├── RuntimeTypeConverterTests.cs
│ │ │ ├── StreamConverterTests.cs
│ │ │ ├── StringArrayConverterTests.cs
│ │ │ ├── TimeSpanConverterTests.cs
│ │ │ ├── TypeConversionUtilsTests.cs
│ │ │ ├── TypeConverterRegistryTests.cs
│ │ │ ├── UniqueKeyConverterTests.cs
│ │ │ └── UriConverterTests.cs
│ │ └── TypeResolution
│ │ ├── aliasedObjects.xml
│ │ ├── CachedTypeResolverTests.cs
│ │ ├── GenericTypeResolverTests.cs
│ │ ├── TypeAssemblyHolderTests.cs
│ │ ├── TypeRegistryTests.cs
│ │ ├── TypeResolutionUtilsTests.cs
│ │ └── TypeResolverTests.cs
│ ├── CoreCompilerOptionsTests.cs
│ ├── CoreExceptionTests.cs
│ ├── Data
│ │ ├── PathMatcher
│ │ │ ├── EmptyPattern.test
│ │ │ ├── Examples.test
│ │ │ ├── InBetween.test
│ │ │ ├── MatchAll.test
│ │ │ ├── PatternsAreCaseSensitive.test
│ │ │ ├── SingleCaracters.test
│ │ │ ├── SlurpPrependedDirectories.test
│ │ │ ├── SpringAssembliesPrefix.test
│ │ │ └── ThisDirectory.test
│ │ └── Spring
│ │ ├── Context
│ │ │ └── Support
│ │ │ └── SPRNET-192.xml
│ │ └── Objects
│ │ └── Factory
│ │ ├── concurrent.xml
│ │ ├── Config
│ │ │ ├── AnotherDaoConfig.xml
│ │ │ ├── DaoConfig.xml
│ │ │ ├── DatabaseConfig.xml
│ │ │ ├── one.properties
│ │ │ ├── PPC-SPRNET-55.xml
│ │ │ ├── PPCTwoLocationsOneSectionTests.xml
│ │ │ ├── PPCTwoLocationsTwoSectionsTests.xml
│ │ │ ├── PPCWithTypesTests.xml
│ │ │ ├── PropertyPlaceholderConfigurerTests.xml
│ │ │ ├── PropertyResourceConfigurerTests.xml
│ │ │ ├── two.properties
│ │ │ └── TypeAliases.xml
│ │ ├── leaf.xml
│ │ ├── middle.xml
│ │ ├── root.xml
│ │ └── Xml
│ │ ├── abstract.xml
│ │ ├── array-autowire.xml
│ │ ├── autowire.xml
│ │ ├── bad-external-resources.xml
│ │ ├── bad-named-constructor-arg.xml
│ │ ├── child.xml
│ │ ├── classnotfound.xml
│ │ ├── collectionMergingGeneric.xml
│ │ ├── collectionMerging.xml
│ │ ├── collections.xml
│ │ ├── constructor-arg.xml
│ │ ├── ctor-args.xml
│ │ ├── default-autowire.xml
│ │ ├── default-lazy-init.xml
│ │ ├── dependenciesmaterializethis.xml
│ │ ├── enums.xml
│ │ ├── event-wiring-prototypes.xml
│ │ ├── event-wiring.xml
│ │ ├── expressions.xml
│ │ ├── external-resources.xml
│ │ ├── factorycircle.xml
│ │ ├── factory-methods.xml
│ │ ├── field-props-factory.xml
│ │ ├── initializers.xml
│ │ ├── invalid-factory.xml
│ │ ├── invalid.xml
│ │ ├── invoke-factory.xml
│ │ ├── lazy-init-multithreaded.xml
│ │ ├── locale.xml
│ │ ├── no-objects.xml
│ │ ├── notfullyspecified.xml
│ │ ├── objectNameGeneration.xml
│ │ ├── parent.xml
│ │ ├── reftypes.xml
│ │ ├── Resources
│ │ │ └── resource-imports.xml
│ │ ├── resource.xml
│ │ ├── satisfiedalldependencycheck.xml
│ │ ├── satisfiedobjectdependencycheck.xml
│ │ ├── satisfiedsimpledependencycheck.xml
│ │ ├── schema-validation.xml
│ │ ├── simple-constructor-arg.xml
│ │ ├── test.xml
│ │ ├── unsatisfiedalldependencycheckmissingobjects.xml
│ │ ├── unsatisfiedAllDependencyCheckMissingSimple.xml
│ │ ├── unsatisfiedobjectdependencycheck.xml
│ │ ├── unsatisfiedsimpledependencycheck.xml
│ │ └── wellformed-but-bad.xml
│ ├── DataBinding
│ │ ├── BaseBindingManagerTests.cs
│ │ └── SimpleExpressionBindingTests.cs
│ ├── ExceptionsTest.cs
│ ├── Expressions
│ │ ├── ConstructorNodeTests.cs
│ │ ├── ExpressionEvaluatorTests.cs
│ │ ├── FunctionNodeTests.cs
│ │ ├── MethodNodeTests.cs
│ │ ├── OpADDTests.cs
│ │ ├── OpANDTests.cs
│ │ ├── OpORTests.cs
│ │ ├── OpXORTests.cs
│ │ ├── Processors
│ │ │ ├── ConversionProcessorTests.cs
│ │ │ └── OrderByProcessorTests.cs
│ │ ├── PropertyOrFieldNodeTests.cs
│ │ ├── ReferenceNodeTests.cs
│ │ └── SelectionNodeTests.cs
│ ├── Globalization
│ │ ├── AbstractLocalizerTests.cs
│ │ ├── CultureInfoUtils.cs
│ │ ├── CultureTestScope.cs
│ │ ├── Formatters
│ │ │ ├── BooleanFormatterTests.cs
│ │ │ ├── CurrencyFormatterTests.cs
│ │ │ ├── DateTimeFormatterTests.cs
│ │ │ ├── FilteringFormatterTests.cs
│ │ │ ├── FloatFormatterTests.cs
│ │ │ ├── HasTextFilteringFormatterTests.cs
│ │ │ ├── IntegerFormatterTests.cs
│ │ │ ├── NumberFormatterTests.cs
│ │ │ └── PercentFormatterTests.cs
│ │ ├── Localizers
│ │ │ └── ResourceSetLocalizerTests.cs
│ │ └── Resolvers
│ │ └── DefaultCultureResolverTests.cs
│ ├── HookableContextHandler.cs
│ ├── Objects
│ │ ├── DerivedTestObject.cs
│ │ ├── Events
│ │ │ └── Support
│ │ │ ├── EventManipulationUtilsTests.cs
│ │ │ └── EventRegistryTests.cs
│ │ ├── ExpressionTestObject.cs
│ │ ├── Factory
│ │ │ ├── AbstractListableObjectFactoryTests.cs
│ │ │ ├── AbstractObjectFactoryTests.cs
│ │ │ ├── Attributes
│ │ │ │ ├── MyRequiredAttribute.cs
│ │ │ │ ├── RequiredAttributeObjectPostProcessorTests.cs
│ │ │ │ ├── RequiredTestObject.cs
│ │ │ │ ├── RequiredWithAllRequiredPropertiesProvided.xml
│ │ │ │ ├── RequiredWithCustomAttribute.xml
│ │ │ │ ├── RequiredWithOneRequiredPropertyOmitted.xml
│ │ │ │ └── RequiredWithThreeRequiredPropertiesOmitted.xml
│ │ │ ├── ConcurrentObjectFactoryTests.cs
│ │ │ ├── Config
│ │ │ │ ├── AbstractFactoryObjectTests.cs
│ │ │ │ ├── CommandLineArgsVariableSourceTests.cs
│ │ │ │ ├── ConfigSectionVariableSourceTests.cs
│ │ │ │ ├── ConfigurableVariableSourceTests.cs
│ │ │ │ ├── ConfigurationReaderTests.cs
│ │ │ │ ├── ConnectionStringsVariableSourceTests.cs
│ │ │ │ ├── ConstructorArgumentValuesTests.cs
│ │ │ │ ├── CustomConverterConfigurerTests.cs
│ │ │ │ ├── DelegateFactoryObjectTests.cs
│ │ │ │ ├── DelegateObjectFactoryConfigurerTests.cs
│ │ │ │ ├── DictionaryFactoryObjectTests.cs
│ │ │ │ ├── DictionaryVariableSourceTests.cs
│ │ │ │ ├── EnvironmentVariableSourceTests.cs
│ │ │ │ ├── EventValuesTests.cs
│ │ │ │ ├── FieldRetrievingFactoryObjectTests.cs
│ │ │ │ ├── ListFactoryObjectTests.cs
│ │ │ │ ├── LogFactoryObjectTests.cs
│ │ │ │ ├── MethodInvokingFactoryObjectTests.cs
│ │ │ │ ├── ObjectDefinitionVisitorTests.cs
│ │ │ │ ├── ObjectFactoryCreatingFactoryObjectTests.cs
│ │ │ │ ├── ObjectReferenceFactoryObjectTests.cs
│ │ │ │ ├── PropertyFileVariableSourceTests.cs
│ │ │ │ ├── PropertyOverrideConfigurerTests.cs
│ │ │ │ ├── PropertyPathFactoryObjectTests.cs
│ │ │ │ ├── PropertyPlaceholderConfigurerTests.cs
│ │ │ │ ├── PropertyRetrievingFactoryObjectTests.cs
│ │ │ │ ├── RegistryVariableSourceTests.cs
│ │ │ │ ├── ResourceHandlerConfigurerTests.cs
│ │ │ │ ├── ResourceManagerFactoryObjectTests.cs
│ │ │ │ ├── RuntimeObjectReferenceTests.cs
│ │ │ │ ├── SetFactoryObjectTests.cs
│ │ │ │ ├── SharedStateAwareProcessorTests.cs
│ │ │ │ ├── SpecialFolderVariableSourceTests.cs
│ │ │ │ ├── TypeAliasConfigurerTests.cs
│ │ │ │ ├── TypedStringValueTests.cs
│ │ │ │ ├── VariableAccessorTests.cs
│ │ │ │ └── VariablePlaceholderConfigurerTests.cs
│ │ │ ├── DefaultListableObjectFactoryPerfTests.cs
│ │ │ ├── DefaultListableObjectFactoryTests.cs
│ │ │ ├── DummyConfigurableFactory.cs
│ │ │ ├── DummyFactory.cs
│ │ │ ├── HasMap.cs
│ │ │ ├── ISideEffectObject.cs
│ │ │ ├── KnowsIfInstantiated.cs
│ │ │ ├── LifecycleObject.cs
│ │ │ ├── MethodReplacerTests.cs
│ │ │ ├── MustBeInitialized.cs
│ │ │ ├── NoSuchObjectDefinitionExceptionTests.cs
│ │ │ ├── ObjectDefinitionStoreExceptionTests.cs
│ │ │ ├── ObjectFactoryUtilsTests.cs
│ │ │ ├── SideEffectObject.cs
│ │ │ ├── Support
│ │ │ │ ├── AutowireUtilsTests.cs
│ │ │ │ ├── ChildObjectDefinitionTests.cs
│ │ │ │ ├── DefaultObjectDefinitionFactoryTests.cs
│ │ │ │ ├── DelegatingMethodReplacerTests.cs
│ │ │ │ ├── LookupMethodOverrideTests.cs
│ │ │ │ ├── LookupMethodReplacerTests.cs
│ │ │ │ ├── ManagedDictionaryTests.cs
│ │ │ │ ├── ManagedListTests.cs
│ │ │ │ ├── ManagedNameValueCollectionTests.cs
│ │ │ │ ├── ManagedSetTests.cs
│ │ │ │ ├── ObjectDefinitionBuilderTests.cs
│ │ │ │ ├── ObjectDefinitionReaderUtilsTests.cs
│ │ │ │ ├── ReplacedMethodOverrideTests.cs
│ │ │ │ ├── RootObjectDefinitionTests.cs
│ │ │ │ └── SimpleInstantiationStrategyTests.cs
│ │ │ ├── TestResource.txt
│ │ │ ├── UnsupportedObjectDefinitionImplementation.cs
│ │ │ └── Xml
│ │ │ ├── ArrayCtorDependencyObject.cs
│ │ │ ├── CollectionMergingGenericTests.cs
│ │ │ ├── CollectionMergingTests.cs
│ │ │ ├── ConstructorDependenciesObject.cs
│ │ │ ├── DependenciesObject.cs
│ │ │ ├── DerivedConstructorDependenciesObject.cs
│ │ │ ├── DoubleBooleanConstructorObject.cs
│ │ │ ├── DummyBo.cs
│ │ │ ├── DummyDao.cs
│ │ │ ├── DummyReferencer.cs
│ │ │ ├── EventWiringTests.cs
│ │ │ ├── FactoryMethods.cs
│ │ │ ├── IDummyBo.cs
│ │ │ ├── InstanceFactory.cs
│ │ │ ├── LocaleTests.cs
│ │ │ ├── MixedCollectionObject.cs
│ │ │ ├── NamespaceParserRegistryTests.cs
│ │ │ ├── NamespaceParserRegistryTests_TestSchema_2.xsd
│ │ │ ├── NamespaceParserRegistryTests_TestSchema.xsd
│ │ │ ├── NullAppender.cs
│ │ │ ├── ObjectFactorySectionHandlerTests.cs
│ │ │ ├── ObjectNameGenerationTests.cs
│ │ │ ├── ReadOnlyXmlTestResource.cs
│ │ │ ├── SiimpleCtorWiringTests.cs
│ │ │ ├── SingleSimpleTypeConstructorObject.cs
│ │ │ ├── TestObjectCreator.cs
│ │ │ ├── XmlListableObjectFactoryTests.cs
│ │ │ ├── XmlObjectCollectionTests.cs
│ │ │ ├── XmlObjectDefinitionReaderTests.cs
│ │ │ ├── XmlObjectDefinitionReaderTests_CustomSchema.xsd
│ │ │ ├── XmlObjectFactoryTests.cs
│ │ │ └── XmlParserResolverTests.cs
│ │ ├── IndexedTestObject.cs
│ │ ├── INestedTestObject.cs
│ │ ├── IOther.cs
│ │ ├── IPerson.cs
│ │ ├── ITestObject.cs
│ │ ├── LazyTestObject.cs
│ │ ├── MutablePropertyValuesTests.cs
│ │ ├── NestedTestObject.cs
│ │ ├── NotWritablePropertyExceptionTests.cs
│ │ ├── NumberTestObject.cs
│ │ ├── ObjectWrapperTests.cs
│ │ ├── PropertyAccessExceptionsExceptionTests.cs
│ │ ├── PropertyValueTests.cs
│ │ ├── ResourceTestObject.cs
│ │ ├── SerializablePerson.cs
│ │ ├── StaticTestEventHandler.cs
│ │ ├── Support
│ │ │ ├── AbstractSharedStateFactoryTests.cs
│ │ │ ├── ArgumentConvertingMethodInvokerTests.cs
│ │ │ ├── AutoWiringEventHandlerValueTests.cs
│ │ │ ├── ByTypeSharedStateProviderTests.cs
│ │ │ ├── InstanceEventHandlerValueTests.cs
│ │ │ ├── MethodInvokerTests.cs
│ │ │ ├── MutableSortDefinitionTests.cs
│ │ │ ├── PropertyComparatorTests.cs
│ │ │ └── StaticEventHandlerValueTests.cs
│ │ ├── TestEventHandler.cs
│ │ ├── TestGenericObject.cs
│ │ ├── TestObject.cs
│ │ ├── TestObjectDAO.cs
│ │ ├── TestObjectList.cs
│ │ ├── TestObject.resx
│ │ ├── TestTransparentProxyFactory.cs
│ │ ├── TypeMismatchExceptionTests.cs
│ │ └── ValidatorTestObject.cs
│ ├── Pool
│ │ └── Support
│ │ └── SimplePoolTest.cs
│ ├── Proxy
│ │ ├── AbstractProxyTypeBuilderTests.cs
│ │ ├── CompositionProxyTypeBuilderTests.cs
│ │ ├── DynamicProxyManagerTests.cs
│ │ ├── ExplicitCompositionProxyTypeBuilderTests.cs
│ │ └── InheritanceProxyTypeBuilderTests.cs
│ ├── Reflection
│ │ └── Dynamic
│ │ ├── BasePropertyTests.cs
│ │ ├── DynamicConstructorTests.cs
│ │ ├── DynamicFieldTests.cs
│ │ ├── DynamicIndexerTests.cs
│ │ ├── DynamicMethodTests.cs
│ │ ├── DynamicPropertyTests.cs
│ │ ├── SafeFieldTests.cs
│ │ ├── SafePropertyTests.cs
│ │ └── SafePropertyTests_TestObject.vb
│ ├── Resources
│ │ ├── Images.resx
│ │ ├── SampleResources.resx
│ │ ├── SimpleAppContext.xml
│ │ ├── Spring.Context.Tests.de-AT.resx
│ │ ├── Spring.Context.Tests.de.resx
│ │ ├── Spring.Context.Tests.pt-BR.resx
│ │ ├── Spring.Context.Tests.resx
│ │ ├── Spring.Context.Tests.sr-Cyrl-CS.resx
│ │ ├── Spring.Context.Tests.sr.resx
│ │ ├── Spring.Context.Tests.sr-SP-Cyrl.resx
│ │ ├── Tesla.resx
│ │ ├── Tesla.sr-Cyrl-CS.resx
│ │ ├── Tesla.sr.resx
│ │ └── Tesla.sr-SP-Cyrl.resx
│ ├── SecurityTemplate.cs
│ ├── Spring.Core.Tests.2002.csproj
│ ├── Spring.Core.Tests.2003.csproj
│ ├── Spring.Core.Tests.2005.csproj
│ ├── Spring.Core.Tests.2008.csproj
│ ├── Spring.Core.Tests.2010.csproj
│ ├── Spring.Core.Tests.build
│ ├── Spring.Core.Tests.dll-1.1.config
│ ├── Spring.Core.Tests.dll.config
│ ├── StandardsComplianceTest.cs
│ ├── StopWatch.cs
│ ├── StreamHelperDecorator.cs
│ ├── TestResourceLoader.cs
│ ├── TestResource.txt
│ ├── Threading
│ │ ├── AsyncTestMethod.cs
│ │ ├── AsyncTestTask.cs
│ │ ├── CallContextStorageTests.cs
│ │ ├── CommonThreadStorageTests.cs
│ │ ├── LatchTest.cs
│ │ ├── LogicalThreadContextTest.cs
│ │ ├── SemaphoreTest.cs
│ │ ├── SyncHolderTest.cs
│ │ └── ThreadStaticStorageTests.cs
│ ├── Util
│ │ ├── ArrayUtilsTests.cs
│ │ ├── AssertUtilsTests.cs
│ │ ├── CollectionUtilsTests.cs
│ │ ├── ConfigXmlDocumentTests.cs
│ │ ├── ConfigXmlDocumentTests_SampleConfig.xml
│ │ ├── DefensiveEventRaiserTests.cs
│ │ ├── DelegateInfoTests.cs
│ │ ├── EventRaiserTests.cs
│ │ ├── NumberUtilsTests.cs
│ │ ├── ObjectUtilsTests.cs
│ │ ├── PathMatcherTest.cs
│ │ ├── PatternMatchUtilsTests.cs
│ │ ├── PropertiesTests.cs
│ │ ├── ReflectionUtilsMemberwiseCopyTests.cs
│ │ ├── ReflectionUtilsTests.cs
│ │ ├── SerializationTestUtils.cs
│ │ ├── StringUtilsTests.cs
│ │ ├── SystemUtilsTests.cs
│ │ └── UniqueKeyTests.cs
│ └── Validation
│ ├── Actions
│ │ ├── ErrorMessageActionTests.cs
│ │ ├── ExceptionActionTests.cs
│ │ └── ExpressionActionTests.cs
│ ├── AnyValidatorGroupTests.cs
│ ├── CollectionValidatorTests.cs
│ ├── ExclusiveValidatorGroupTests.cs
│ ├── HelperClasses.cs
│ ├── ValidationErrorsTests.cs
│ ├── ValidationExceptionTests.cs
│ ├── ValidationNamespaceParserTests.cs
│ ├── ValidationNamespaceParserTests_WhenConfigFileIsNotValid.xml
│ ├── ValidationNamespaceParserTests_WhenConfigFileIsValid.xml
│ ├── ValidatorGroupTests.cs
│ ├── ValidatorReferenceTests.cs
│ └── Validators
│ ├── ConditionValidatorTests.cs
│ ├── CreditCardValidatorTests.cs
│ ├── EmailValidatorTests.cs
│ ├── Integration
│ │ ├── CreditCardValidatorIntegrationTests.cs
│ │ ├── EmailValidatorIntegrationTests.cs
│ │ ├── ISBNValidatorIntegrationTests.cs
│ │ └── UrlValidatorIntegrationTests.cs
│ ├── ISBNValidatorTests.cs
│ ├── RegularExpressionValidatorTests.cs
│ ├── RequiredValidatorTests.cs
│ └── UrlValidatorTests.cs
├── Spring.Data.Integration.Tests
│ ├── Data
│ │ ├── AccountCreditDao.cs
│ │ ├── AccountDebitDao.cs
│ │ ├── AccountManager.cs
│ │ ├── AdoDaoTests.cs
│ │ ├── AdoTemplatePerformanceTests.cs
│ │ ├── AdoTemplateTests.cs
│ │ ├── adoTemplateTests.xml
│ │ ├── autoDeclarativeServices.xml
│ │ ├── AutoDeclarativeTxTests.cs
│ │ ├── CallCreateTestObject.cs
│ │ ├── ConsoleLoggingAroundAdvice.cs
│ │ ├── CreateTestObjectNonQuery.cs
│ │ ├── CreateTestObject.sql
│ │ ├── CreditsDebitsSchema.sql
│ │ ├── declarativeServices.xml
│ │ ├── DeclarativeTxTests.cs
│ │ ├── DTC1.1AppContext.xml
│ │ ├── DTCAppContextNoInterfaces.xml
│ │ ├── DTCAppContext.xml
│ │ ├── DTCTests.cs
│ │ ├── DTCTestsNoInterfaces.cs
│ │ ├── Generic
│ │ │ ├── GenericAdoTemplateTests.cs
│ │ │ ├── GenericAdoTemplateTests.xml
│ │ │ ├── ITestObjectDao.cs
│ │ │ ├── TestObjectDao.cs
│ │ │ └── TestObjectRowMapper.cs
│ │ ├── IAccountCreditDao.cs
│ │ ├── IAccountDebitDao.cs
│ │ ├── IAccountManager.cs
│ │ ├── ITestCoordinator.cs
│ │ ├── ITestObjectDao.cs
│ │ ├── ITestObjectManager.cs
│ │ ├── MappingAdoQueryTests.cs
│ │ ├── NativeAdoTestObjectDao.cs
│ │ ├── NativeAdoTests.cs
│ │ ├── nativeAdoTests.xml
│ │ ├── NestedTxScopeTests.cs
│ │ ├── Northwind
│ │ │ ├── AdoTemplateShipperDao.cs
│ │ │ ├── IShipperDao.cs
│ │ │ ├── NativeAdoShipperDao.cs
│ │ │ └── Shipper.cs
│ │ ├── Objects
│ │ │ └── Generic
│ │ │ ├── MappingVacationQuery.cs
│ │ │ ├── StoredProcedureTests.cs
│ │ │ ├── Vacation.cs
│ │ │ └── VacationRowMapper.cs
│ │ ├── OracleAdoTemplateTests.cs
│ │ ├── oracleAdoTemplateTests.xml
│ │ ├── SimpleAccountCreditDao.cs
│ │ ├── SimpleAccountDebitDao.cs
│ │ ├── SimpleAccountManager.cs
│ │ ├── SQLiteTests.cs
│ │ ├── StoredProcedureTests.cs
│ │ ├── Support
│ │ │ └── SimpleExceptionTranslationTests.cs
│ │ ├── templateTests.xml
│ │ ├── TestCoordinator.cs
│ │ ├── TestObjectDao.cs
│ │ ├── TestObjectManager.cs
│ │ ├── TestObjectQuery.cs
│ │ ├── testobjects-sqlserver.sql
│ │ ├── TestObjectStoredProcedure.cs
│ │ ├── TestTxIsolationLevelTests.cs
│ │ ├── TestTxIsolationLevel.xml
│ │ └── TransactionTemplateTests.cs
│ ├── Spring.Data.Integration.Tests.2003.csproj
│ ├── Spring.Data.Integration.Tests.2005.csproj
│ ├── Spring.Data.Integration.Tests.2008.csproj
│ ├── Spring.Data.Integration.Tests.2010.csproj
│ ├── Spring.Data.Integration.Tests.build
│ └── Spring.Data.Integration.Tests.dll.config
├── Spring.Data.NHibernate20.Integration.Tests
│ ├── Data
│ │ └── NHibernate
│ │ ├── Credit.hbm.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── templateTests.xml
│ │ └── TestObject.hbm.xml
│ ├── RecreateDatabases.sql
│ ├── Setup.cs
│ ├── Spring.Data.NHibernate20.Integration.Tests.2005.csproj
│ ├── Spring.Data.NHibernate20.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate20.Integration.Tests.build
│ └── Spring.Data.NHibernate20.Integration.Tests.dll.config
├── Spring.Data.NHibernate20.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── HibernateCompilerOptionsTests.cs
│ ├── HibernateExceptionTests.cs
│ ├── Spring.Data.NHibernate20.Tests.2005.csproj
│ ├── Spring.Data.NHibernate20.Tests.2008.csproj
│ ├── Spring.Data.NHibernate20.Tests.2010.csproj
│ ├── Spring.Data.NHibernate20.Tests.build
│ └── Spring.Data.NHibernate20.Tests.dll.config
├── Spring.Data.NHibernate21.Integration.Tests
│ ├── Config
│ │ └── Log4Net.xml
│ ├── Data
│ │ └── NHibernate
│ │ ├── AccountController.cs
│ │ ├── Bytecode
│ │ │ ├── AbstractInjectableUserTypeFixture.cs
│ │ │ ├── Foo.cs
│ │ │ ├── Foo.Spechbm.xml
│ │ │ ├── IDelimiter.cs
│ │ │ ├── InjectableStringUserType.cs
│ │ │ ├── InjectableUserTypeFixture.cs
│ │ │ ├── NHibernateTestImports.cs
│ │ │ └── Product.cs
│ │ ├── Controllers.xml
│ │ ├── Credit.hbm.xml
│ │ ├── Dao.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── HibernateTxScopeTransactionManagerTests.cs
│ │ ├── HibernateTxScopeTransactionManagerTests.xml
│ │ ├── IAccountController.cs
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── Services.xml
│ │ ├── SimpleTestDao.cs
│ │ ├── templateTests.xml
│ │ ├── TestObject.hbm.xml
│ │ └── txScopeBugTests.xml
│ ├── NHibernate.Test.dll.config
│ ├── README.TXT
│ ├── RecreateDatabases.sql
│ ├── Setup.cs
│ ├── Spring.Data.NHibernate21.Integration.Tests.2005.csproj
│ ├── Spring.Data.NHibernate21.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate21.Integration.Tests.2010.csproj
│ ├── Spring.Data.NHibernate21.Integration.Tests.build
│ ├── Spring.Data.NHibernate21.Integration.Tests.dll.config
│ └── TestEnbeddedConfig.cfg.xml
├── Spring.Data.NHibernate21.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── DelegatingLocalSessionFactoryObjectTests.cs
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── HibernateCompilerOptionsTests.cs
│ ├── HibernateExceptionTests.cs
│ ├── Spring.Data.NHibernate21.Tests.2005.csproj
│ ├── Spring.Data.NHibernate21.Tests.2008.csproj
│ ├── Spring.Data.NHibernate21.Tests.2010.csproj
│ ├── Spring.Data.NHibernate21.Tests.build
│ └── Spring.Data.NHibernate21.Tests.dll.config
├── Spring.Data.NHibernate30.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Credit.hbm.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── templateTests.xml
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate30.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate30.Integration.Tests.2010.csproj
│ ├── Spring.Data.NHibernate30.Integration.Tests.build
│ └── Spring.Data.NHibernate30.Integration.Tests.dll.config
├── Spring.Data.NHibernate30.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate30.Tests.2008.csproj
│ ├── Spring.Data.NHibernate30.Tests.2010.csproj
│ ├── Spring.Data.NHibernate30.Tests.build
│ └── Spring.Data.NHibernate30.Tests.dll.config
├── Spring.Data.NHibernate31.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Credit.hbm.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── templateTests.xml
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate31.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate31.Integration.Tests.build
│ └── Spring.Data.NHibernate31.Integration.Tests.dll.config
├── Spring.Data.NHibernate31.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate31.Tests.2008.csproj
│ ├── Spring.Data.NHibernate31.Tests.2010.csproj
│ ├── Spring.Data.NHibernate31.Tests.build
│ └── Spring.Data.NHibernate31.Tests.dll.config
├── Spring.Data.NHibernate32.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Credit.hbm.xml
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.hbm.xml
│ │ ├── MultipleDbTests.xml
│ │ ├── NHDAOTests.xml
│ │ ├── templateTests.xml
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate32.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate32.Integration.Tests.build
│ └── Spring.Data.NHibernate32.Integration.Tests.dll.config
├── Spring.Data.NHibernate32.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── Support
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate32.Tests.2008.csproj
│ ├── Spring.Data.NHibernate32.Tests.2010.csproj
│ ├── Spring.Data.NHibernate32.Tests.build
│ └── Spring.Data.NHibernate32.Tests.dll.config
├── Spring.Data.NHibernate.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── AccountCreditDao.cs
│ │ ├── AccountDebitDao.cs
│ │ ├── AccountManager.cs
│ │ ├── AuditDao.cs
│ │ ├── Credit.cs
│ │ ├── creditdebit.sql
│ │ ├── Credit.hbm.xml
│ │ ├── DbProviderTemplateTests.cs
│ │ ├── dbProviderTemplateTests.xml
│ │ ├── Debit.cs
│ │ ├── Debit.hbm.xml
│ │ ├── IAccountCreditDao.cs
│ │ ├── IAccountDebitDao.cs
│ │ ├── IAccountManager.cs
│ │ ├── IAuditDao.cs
│ │ ├── ITestObjectDao.cs
│ │ ├── MultipleDbTests.cs
│ │ ├── MultipleDbTests.xml
│ │ ├── NativeNHTestObjectDao.cs
│ │ ├── NativeNHTests.cs
│ │ ├── NHDAOTests.cs
│ │ ├── NHDAOTests.xml
│ │ ├── NHTestObjectDao.cs
│ │ ├── TemplateTests.cs
│ │ ├── templateTests.xml
│ │ ├── TestObject.cs
│ │ ├── TestObject.hbm.xml
│ │ └── testObject.sql
│ ├── Spring.Data.NHibernate.Integration.Tests.2003.csproj
│ ├── Spring.Data.NHibernate.Integration.Tests.2005.csproj
│ ├── Spring.Data.NHibernate.Integration.Tests.2008.csproj
│ ├── Spring.Data.NHibernate.Integration.Tests.2010.csproj
│ ├── Spring.Data.NHibernate.Integration.Tests.build
│ └── Spring.Data.NHibernate.Integration.Tests.dll.config
├── Spring.Data.NHibernate.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ └── NHibernate
│ │ ├── Config
│ │ │ ├── AopConfiguration.cs
│ │ │ ├── AopConfigurationTxPointcut.xml
│ │ │ └── AopConfiguration.xml
│ │ ├── HibernateTransactionManagerTests.cs
│ │ ├── ISimpleService.cs
│ │ ├── ITestObjectDao.cs
│ │ ├── LocalSessionFactoryObjectTests.cs
│ │ ├── NHTestObjectDao.cs
│ │ ├── SessionFactoryUtilsTests.cs
│ │ ├── SimpleService.cs
│ │ ├── Support
│ │ │ ├── ConfigSectionSessionScopeSettingsTests.cs
│ │ │ ├── SessionScopeSettingsTests.cs
│ │ │ └── SessionScopeTests.cs
│ │ ├── TestObject.cs
│ │ └── TestObject.hbm.xml
│ ├── Spring.Data.NHibernate.Tests.2003.csproj
│ ├── Spring.Data.NHibernate.Tests.2005.csproj
│ ├── Spring.Data.NHibernate.Tests.2008.csproj
│ ├── Spring.Data.NHibernate.Tests.build
│ └── Spring.Data.NHibernate.Tests.dll.config
├── Spring.Data.Tests
│ ├── AssemblyInfo.cs
│ ├── Dao
│ │ ├── Attributes
│ │ │ ├── PersistenceExceptionTranslationAdvisorTests.cs
│ │ │ ├── PersistenceExceptionTranslationInterceptorTests.cs
│ │ │ └── PersistenceExceptionTranslationPostProcessorTests.cs
│ │ ├── IncorrectResultSizeDataAccessExceptionTests.cs
│ │ ├── IncorrectUpdateSemanticsDataAccessExceptionTests.cs
│ │ ├── Support
│ │ │ └── DataAccessUtilsTests.cs
│ │ └── UncategorizedDataAccessExceptionTests.cs
│ ├── Data
│ │ ├── AdoPlatformTransactionManagerTests.cs
│ │ ├── AutoDeclarativeTxTests.cs
│ │ ├── AutoDeclarativeTxTests.xml
│ │ ├── Common
│ │ │ ├── AdditionalProviders.xml
│ │ │ ├── DbParametersTests.cs
│ │ │ ├── DbProviderFactoryTests.cs
│ │ │ ├── DbProviderFactoryTests.xml
│ │ │ ├── MultiDelegatingDbProviderTests.cs
│ │ │ └── UserCredentialsDbProviderTests.cs
│ │ ├── Core
│ │ │ ├── ServiceDomainTransactionManagerTests.cs
│ │ │ ├── TxScopeTransactionManagerIntegrationTests.cs
│ │ │ └── TxScopeTransactionManagerTests.cs
│ │ ├── ITestCoord.cs
│ │ ├── ITestObjectMgr.cs
│ │ ├── LoggingAroundAdvice.cs
│ │ ├── Objects
│ │ │ ├── AbstractAdoQueryTests.cs
│ │ │ ├── AdoOperationTests.cs
│ │ │ ├── AdoQueryTests.cs
│ │ │ └── StoredProcedureTests.cs
│ │ ├── TestCoord.cs
│ │ └── TestObjectMgr.cs
│ ├── DataCompilerOptionsTests.cs
│ ├── DataExceptionTests.cs
│ ├── Spring.Data.Tests.2003.csproj
│ ├── Spring.Data.Tests.2005.csproj
│ ├── Spring.Data.Tests.2008.csproj
│ ├── Spring.Data.Tests.2010.csproj
│ ├── Spring.Data.Tests.build
│ ├── Spring.Data.Tests.dll.config
│ ├── Support
│ │ ├── ErrorCodeExceptionTranslatorTests.cs
│ │ ├── TestDbProvider.cs
│ │ └── TestSqlException.cs
│ └── Transaction
│ ├── CallCountingTransactionManager.cs
│ ├── CommonTypes.cs
│ ├── Config
│ │ ├── TxNamespaceParserTests.cs
│ │ ├── TxNamespaceParserTests_TxAttributeDriven.xml
│ │ └── TxNamespaceParserTests.xml
│ ├── HeuristicCompletionExceptionTests.cs
│ ├── Interceptor
│ │ ├── AbstractTransactionAspectTests.cs
│ │ ├── DefaultTransactionAttributeTests.cs
│ │ ├── MatchAlwaysTransactionAttributeSourceTests.cs
│ │ ├── MatchAlwaysTransactionAttributeSourceTests.xml
│ │ ├── NoRollbackRuleAttributeTests.cs
│ │ ├── RollbackRuleAttributeTests.cs
│ │ ├── RuleBasedTransactionAttributeTests.cs
│ │ ├── TransactionAttributeEditorTests.cs
│ │ ├── TransactionAttributeSourceAdvisorTests.cs
│ │ ├── TransactionAttributeSourceEditorTests.cs
│ │ ├── TransactionAttributeSourceTests.cs
│ │ └── TransactionInterceptorTests.cs
│ ├── InvalidTimeoutExceptionTests.cs
│ └── Support
│ ├── AbstractPlatformTransactionManagerTests.cs
│ ├── DefaultTransactionDefinitionTests.cs
│ ├── DefaultTransactionStatusTests.cs
│ ├── ResourceHolderSupportTests.cs
│ ├── TransactionSynchronizationAdapterTests.cs
│ ├── TransactionSynchronizationManagerTests.cs
│ └── TransactionTemplateTests.cs
├── Spring.Messaging.Ems.Tests
│ ├── AssemblyInfo.cs
│ ├── Messaging
│ │ └── Ems
│ │ ├── Connections
│ │ │ ├── CachingConnectionFactoryTests.cs
│ │ │ ├── MessageTransactionManagerTests.cs
│ │ │ ├── SingleConnectionFactoryTests.cs
│ │ │ ├── TestConnection.cs
│ │ │ ├── TestExceptionListener.cs
│ │ │ ├── TestMessageConsumer.cs
│ │ │ ├── TestMessageListener.cs
│ │ │ ├── TestMessageProducer.cs
│ │ │ ├── TestSession.cs
│ │ │ └── TestTopicSubscriber.cs
│ │ ├── Core
│ │ │ ├── MessageTemplateTests.cs
│ │ │ ├── SimpleMessageConverterTests.cs
│ │ │ └── SimpleMessageListenerContainerTests.cs
│ │ ├── Integration
│ │ │ ├── LoggingExceptionHandler.cs
│ │ │ ├── SimpleMessageListenerContainerTests.cs
│ │ │ ├── SimpleMessageListenerContainerTests.xml
│ │ │ └── SimpleMessageListener.cs
│ │ └── Jndi
│ │ ├── ExpectedLookupContext.cs
│ │ └── JndiLookupFactoryObjectTests.cs
│ ├── Spring.Messaging.Ems.Tests.2005.csproj
│ ├── Spring.Messaging.Ems.Tests.2008.csproj
│ ├── Spring.Messaging.Ems.Tests.2010.csproj
│ ├── Spring.Messaging.Ems.Tests.build
│ └── Spring.Messaging.Ems.Tests.dll.config
├── Spring.Messaging.Nms.Integration.Tests
│ ├── AssemblyInfo.cs
│ ├── Messaging
│ │ └── Nms
│ │ ├── Core
│ │ │ ├── NmsTemplateTests.cs
│ │ │ ├── NmsTemplateTests.xml
│ │ │ ├── SimpleGateway.cs
│ │ │ └── SimpleMessageListener.cs
│ │ └── Listener
│ │ ├── SimpleMessageListenerContainerTests.cs
│ │ └── SimpleMessageListenerContainerTests.xml
│ ├── Properties
│ ├── Spring.Messaging.Nms.Integration.Tests.build
│ ├── Spring.Messaging.Nms.Integration.Tests.csproj
│ └── Spring.Messaging.Nms.Integration.Tests.dll.config
├── Spring.Messaging.Nms.Tests
│ ├── AssemblyInfo.cs
│ ├── Messaging
│ │ └── Nms
│ │ ├── Config
│ │ │ ├── NmsNamespaceHandlerTests.cs
│ │ │ └── NmsNamespaceHandlerTests.xml
│ │ ├── Connections
│ │ │ ├── CachingConnectionFactoryTests.cs
│ │ │ ├── MessageTransactionManagerTests.cs
│ │ │ ├── SingleConnectionFactoryTests.cs
│ │ │ ├── TestConnection.cs
│ │ │ ├── TestConnectionFactory.cs
│ │ │ ├── TestExceptionListener.cs
│ │ │ ├── TestMessageConsumer.cs
│ │ │ ├── TestMessageListener.cs
│ │ │ ├── TestMessageProducer.cs
│ │ │ └── TestSession.cs
│ │ ├── Core
│ │ │ ├── MessageTemplateTests.cs
│ │ │ ├── SimpleMessageConverterTests.cs
│ │ │ └── SimpleMessageListenerContainerTests.cs
│ │ ├── Integration
│ │ │ ├── LoggingExceptionHandler.cs
│ │ │ ├── SimpleMessageListenerContainerTests.cs
│ │ │ ├── SimpleMessageListenerContainerTests.xml
│ │ │ └── SimpleMessageListener.cs
│ │ ├── Listener
│ │ │ └── Adapter
│ │ │ ├── IMessageContentsHandler.cs
│ │ │ ├── MessageContentsHandler.cs
│ │ │ └── MessageListenerAdapterTests.cs
│ │ ├── StubQueue.cs
│ │ └── Support
│ │ └── Converter
│ │ └── TypeMapperTests.cs
│ ├── NmsCompilerOptionsTests.cs
│ ├── NmsExceptionTests.cs
│ ├── Properties
│ ├── Spring.Messaging.Nms.Tests.2003.csproj
│ ├── Spring.Messaging.Nms.Tests.2005.csproj
│ ├── Spring.Messaging.Nms.Tests.2008.csproj
│ ├── Spring.Messaging.Nms.Tests.2010.csproj
│ ├── Spring.Messaging.Nms.Tests.build
│ └── Spring.Messaging.Nms.Tests.dll.config
├── Spring.Messaging.Tests
│ ├── Messaging
│ │ ├── Core
│ │ │ ├── MessageQueueMetadataCacheTests.cs
│ │ │ ├── MessageQueueMetadataCacheTests.xml
│ │ │ ├── MessageQueueTemplateTests.cs
│ │ │ ├── MessageQueueTemplateTests.xml
│ │ │ ├── MessageQueueUtils.cs
│ │ │ └── ThreadingTests.cs
│ │ ├── Listener
│ │ │ ├── Adapter
│ │ │ │ ├── MessageListenerAdapterTests.cs
│ │ │ │ └── StandardReflectionMessageListenerAdapter.cs
│ │ │ ├── DistributedTxMessageListenerContainerTests.cs
│ │ │ ├── DistributedTxMessageListenerContainerTests.xml
│ │ │ ├── LoggingExceptionHandler.cs
│ │ │ ├── MultiThreadedNonTransactionalMessageListenerContainerTests.cs
│ │ │ ├── MultiThreadedNonTransactionalMessageListenerContainerTests.xml
│ │ │ ├── NonTransactionalMessageListenerContainerTests.cs
│ │ │ ├── NonTransactionalMessageListenerContainerTests.xml
│ │ │ ├── SimpleExceptionHandler.cs
│ │ │ ├── SimpleHandler.cs
│ │ │ ├── SimpleMessageListener.cs
│ │ │ ├── TransactionalMessageListenerContainerTests.cs
│ │ │ ├── TransactionalMessageListenerContainerTests.xml
│ │ │ └── WaitingHandler.cs
│ │ ├── queue-context.xml
│ │ └── Support
│ │ ├── MessageAlreadyProcessedException.cs
│ │ └── MessageQueueFactoryObjectTests.cs
│ ├── MessagingCompilerOptionsTests.cs
│ ├── MessagingExceptionTests.cs
│ ├── Properties
│ │ └── AssemblyInfo.cs
│ ├── Spring.Messaging.Tests.2005.csproj
│ ├── Spring.Messaging.Tests.2008.csproj
│ ├── Spring.Messaging.Tests.2010.csproj
│ ├── Spring.Messaging.Tests.build
│ └── Spring.Messaging.Tests.dll.config
├── Spring.Scheduling.Quartz.Tests
│ ├── job-scheduling-data.xml
│ ├── multipleAnonymousMethodInvokingJobDetailFB.xml
│ ├── multipleSchedulers.xml
│ ├── QuartzCompilerOptionsTests.cs
│ ├── schedulerAccessorObject.xml
│ ├── schedulerRepositoryExposure.xml
│ ├── Scheduling
│ │ └── Quartz
│ │ ├── AdaptableJobFactoryTest.cs
│ │ ├── CronTriggerObjectTest.cs
│ │ ├── JobDetailObjectTest.cs
│ │ ├── MethodInvokingJobDetailFactoryObjectTest.cs
│ │ ├── MethodInvokingJobTest.cs
│ │ ├── QuartzSupportTests.cs
│ │ ├── QuartzTestObject.cs
│ │ ├── SchedulerFactoryObjectTest.cs
│ │ ├── SimpleTriggerObjectTest.cs
│ │ ├── SpringObjectJobFactoryTest.cs
│ │ ├── TestMethodInvokingTask.cs
│ │ ├── TestUtil.cs
│ │ └── TriggerObjectTest.cs
│ ├── Spring.Scheduling.Quartz.Tests.2003.csproj
│ ├── Spring.Scheduling.Quartz.Tests.2005.csproj
│ ├── Spring.Scheduling.Quartz.Tests.2008.csproj
│ ├── Spring.Scheduling.Quartz.Tests.2010.csproj
│ ├── Spring.Scheduling.Quartz.Tests.build
│ └── Spring.Scheduling.Quartz.Tests.dll.config
├── Spring.Services.Tests
│ ├── AssemblyInfo.cs
│ ├── Data
│ │ ├── Spring
│ │ │ ├── Remoting
│ │ │ │ ├── autowire.xml
│ │ │ │ ├── caoLifetimeService.xml
│ │ │ │ ├── cao.xml
│ │ │ │ ├── remotingConfigurer.xml
│ │ │ │ ├── saoLifetimeService.xml
│ │ │ │ ├── saoSingleCall.xml
│ │ │ │ ├── saoSingleton-aop.xml
│ │ │ │ ├── saoSingleton-autowired.xml
│ │ │ │ └── saoSingleton.xml
│ │ │ ├── Web
│ │ │ │ └── Services
│ │ │ │ ├── configurableFactory.xml
│ │ │ │ ├── document-literal.wsdl
│ │ │ │ ├── nestedSchema.wsdl
│ │ │ │ ├── nestedSchema.xsd
│ │ │ │ ├── rpc-literal.wsdl
│ │ │ │ └── Service.cs.fyi
│ │ │ └── WindowsService
│ │ │ ├── Cassini
│ │ │ │ ├── localizer.xml
│ │ │ │ ├── service.config
│ │ │ │ ├── service.xml
│ │ │ │ ├── watcher.xml
│ │ │ │ └── wwwroot
│ │ │ ├── Echo
│ │ │ │ ├── service.config
│ │ │ │ ├── service.xml
│ │ │ │ └── watcher.xml
│ │ │ └── Simple
│ │ │ ├── service.config
│ │ │ ├── service.xml
│ │ │ └── watcher.xml
│ │ └── Xml
│ │ ├── watcher-0.xml
│ │ ├── watcher-1.xml
│ │ └── watcher-simple.xml
│ ├── EnterpriseServices
│ │ ├── ExeConfigurationSystemTests.config
│ │ ├── ExeConfigurationSystemTests.cs
│ │ ├── ExportedServicedComponentSample.cs
│ │ └── ServicedComponentExporterTests.cs
│ ├── Remoting
│ │ ├── BaseRemotingTestFixture.cs
│ │ ├── CaoExporterTests.cs
│ │ ├── CaoFactoryObjectTests.cs
│ │ ├── ISimpleCounter.cs
│ │ ├── RemoteObjectFactoryTests.cs
│ │ ├── RemotingConfigParserTests.cs
│ │ ├── RemotingConfigurerTests.cs
│ │ ├── SaoExporterTests.cs
│ │ ├── SaoFactoryObjectTests.cs
│ │ └── SimpleCounter.cs
│ ├── ServiceComponentExporterTests.TestServicedComponents.dll.config
│ ├── ServiceComponentExporterTests.TestServicedComponents.exe.config
│ ├── ServiceComponentExporterTests.TestServicedComponents.Services.xml
│ ├── ServiceModel
│ │ ├── Config
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.BasicConfig.xml
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.cs
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.CustomProperties.xml
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.WithoutId.xml
│ │ │ ├── ChannelFactoryObjectDefinitionParserTests.WithTypeAlias.xml
│ │ │ └── WcfNamespaceParserTests.cs
│ │ ├── ServiceExporterTests.cs
│ │ └── SpringServiceHostTests.cs
│ ├── ServicesCompilerOptionsTests.cs
│ ├── Spring.Services.Tests.2003.csproj
│ ├── Spring.Services.Tests.2005.csproj
│ ├── Spring.Services.Tests.2008.csproj
│ ├── Spring.Services.Tests.2010.csproj
│ ├── Spring.Services.Tests.build
│ ├── Spring.Services.Tests.dll-1.1.config
│ ├── Spring.Services.Tests.dll.config
│ ├── Spring.Services.WindowsService.Samples.csproj
│ ├── Spring.Services.WindowsService.Tests.build
│ ├── Spring.Services.WindowsService.Tests.csproj
│ ├── tests.config
│ ├── Web
│ │ └── Services
│ │ └── WebServiceProxyFactoryTests.cs
│ └── WindowsService
│ ├── Common
│ │ ├── ApplicationHostTest.cs
│ │ ├── ApplicationTest.cs
│ │ ├── Deploy
│ │ │ ├── AggregatedDeployEventDispatcherTest.cs
│ │ │ ├── ApplicationWatcherManagerTest.cs
│ │ │ ├── DeployEventAggregatorTest.cs
│ │ │ ├── DeployManagerTest.cs
│ │ │ ├── FileSystem
│ │ │ │ ├── DefaultApplicationWatcherFactoryTest.cs
│ │ │ │ ├── FileSystemApplicationWatcherTest.cs
│ │ │ │ ├── FileSystemDeployLocationTest.cs
│ │ │ │ ├── FileSystemMonitorTest.cs
│ │ │ │ └── RegularExpressionFilterConfigurerTest.cs
│ │ │ ├── NullSync.cs
│ │ │ ├── SpringAssembliesDeployerTest.cs
│ │ │ └── TestingHandler.cs
│ │ ├── Gui
│ │ │ └── ApplicationMonitorTest.cs
│ │ ├── LocalizerTest.cs
│ │ ├── ServiceSupportTest.cs
│ │ └── UtilsTest.cs
│ ├── IntegrationTest.cs
│ ├── Samples
│ │ ├── ASMXExecutor.cs
│ │ ├── Echo
│ │ │ └── Echo.cs
│ │ ├── echo.asmx
│ │ ├── service.config
│ │ ├── service.xml
│ │ ├── Simple
│ │ │ └── Simple.cs
│ │ ├── Simple.cs
│ │ └── watcher.xml
│ └── TestUtils.cs
├── Spring.Template.Velocity.Tests
│ ├── Properties
│ ├── Spring.Template.Velocity.Tests.2010.csproj
│ ├── Spring.Template.Velocity.Tests.build
│ ├── Spring.Template.Velocity.Tests.csproj
│ ├── Template
│ │ └── Velocity
│ │ ├── Config
│ │ │ └── TemplateNamespaceParserTests.cs
│ │ ├── config.properties
│ │ ├── EmbeddedTemplate.vm
│ │ ├── SimpleTemplate.vm
│ │ ├── VelocityEngineFactoryObjectTests.cs
│ │ ├── VelocityEngineFactoryObjectTests.xml
│ │ └── VelocityEngineTestBase.cs
│ └── VelocityCompilerOptionsTests.cs
├── Spring.Testing.Microsoft.Tests
│ ├── app.config
│ ├── AssemblyInfo.cs
│ ├── Properties
│ ├── Spring.Testing.Microsoft.Tests.2008.csproj
│ ├── Spring.Testing.Microsoft.Tests.2010.csproj
│ ├── Spring.Testing.Microsoft.Tests.build
│ ├── Spring.Testing.Microsoft.Tests.dll.config
│ └── Testing
│ └── Microsoft
│ ├── AbstractDependencyInjectionSpringContextTestsTests.cs
│ └── TestApplicationContext.xml
├── Spring.Testing.NUnit.Tests
│ ├── AssemblyInfo.cs
│ ├── NUnitCompilerOptionsTests.cs
│ ├── Spring.Testing.NUnit.Tests.2003.csproj
│ ├── Spring.Testing.NUnit.Tests.2005.csproj
│ ├── Spring.Testing.NUnit.Tests.2008.csproj
│ ├── Spring.Testing.NUnit.Tests.2010.csproj
│ ├── Spring.Testing.NUnit.Tests.build
│ ├── Spring.Testing.NUnit.Tests.dll.config
│ └── Testing
│ ├── Ado
│ │ └── SimpleAdoTestUtilsTests.cs
│ └── NUnit
│ ├── AbstractDependencyInjectionSpringContextTestsTests.cs
│ └── TestApplicationContext.xml
├── Spring.Web.Mvc3.Tests
│ ├── ControllerFactoryTestExtension.cs
│ ├── Controllers
│ │ ├── FirstContainerRegisteredController.cs
│ │ ├── NamedContextController.cs
│ │ ├── NotInContainerController.cs
│ │ └── SecondContainerRegisteredController.cs
│ ├── namedContextObjectsMvc3.xml
│ ├── objectsMvc3.xml
│ ├── Properties
│ ├── SpringMvcDependencyResolverTests.cs
│ ├── Spring.Web.Mvc3.Tests.2010.csproj
│ └── Spring.Web.Mvc3.Tests.build
├── Spring.Web.Mvc.Tests
│ ├── ControllerFactoryTestExtension.cs
│ ├── Controllers
│ │ ├── FirstContainerRegisteredController.cs
│ │ ├── NamedContextController.cs
│ │ ├── NotInContainerController.cs
│ │ └── SecondContainerRegisteredController.cs
│ ├── namedContextObjects.xml
│ ├── objectsMatchByType.xml
│ ├── objects.xml
│ ├── Properties
│ ├── SpringControllerFactoryTests.cs
│ ├── Spring.Web.Mvc.Tests.2010.csproj
│ └── Spring.Web.Mvc.Tests.build
└── Spring.Web.Tests
├── AssemblyInfo.cs
├── Caching
│ └── AspNetCacheTests.cs
├── Context
│ └── Support
│ ├── HttpApplicationConfigurerMergablePropertiesTests.xml
│ ├── HttpApplicationConfigurerTests.cs
│ ├── HttpApplicationConfigurerTests.xml
│ ├── WebApplicationContextArgsTests.cs
│ ├── WebApplicationContextTests.cs
│ ├── WebContextHandlerTests.cs
│ └── WebContextHandlerTests.xml
├── Core
│ └── IO
│ └── WebResourceTests.cs
├── Data
│ └── Spring
│ ├── Context
│ │ └── Support
│ │ └── WebApplicationContextTests
│ │ ├── Dummy.aspx
│ │ └── Web.Config
│ ├── Objects
│ │ └── Factory
│ │ └── Support
│ │ ├── TestForm.aspx
│ │ └── TestForm.aspx.cs
│ └── Web
│ └── Support
│ ├── LocalResourceManagerTests
│ │ ├── App_LocalResources
│ │ │ └── WithResources.aspx.resx
│ │ ├── Web.Config
│ │ ├── WithoutResources.aspx
│ │ └── WithResources.aspx
│ └── PageHandlerFactoryTests
│ ├── DisablesSession.aspx
│ ├── MaintainsSession1.aspx
│ ├── MaintainsSession2.aspx
│ ├── ReadOnlySession.aspx
│ ├── TransferAfterSetResult.aspx
│ ├── TransferAfterSetResultSave.aspx
│ ├── Web.Config.net-1.1
│ └── Web.Config.net-2.0
├── Globalization
│ └── Resolvers
│ └── DefaultWebCultureResolverTests.cs
├── Objects
│ └── Factory
│ ├── Support
│ │ ├── WebObjectDefinitionFactoryTests.cs
│ │ ├── WebObjectDefinitionTests.cs
│ │ ├── WebObjectFactoryTests.cs
│ │ └── WebObjectUtilsTests.cs
│ └── Xml
│ └── WebObjectDefinitionReaderTests.cs
├── Spring.Web.Tests.2003.csproj
├── Spring.Web.Tests.2005.csproj
├── Spring.Web.Tests.2008.csproj
├── Spring.Web.Tests.2010.csproj
├── Spring.Web.Tests.build
├── TestSupport
│ ├── DictionaryModelPersistenceMedium.cs
│ ├── NUnitAdapter.cs
│ ├── SessionMock.cs
│ ├── TestPage.cs
│ ├── TestUserControl.cs
│ ├── TestWebContext.cs
│ ├── TestWebContextTests.cs
│ ├── VirtualEnvironmentMock.cs
│ ├── VoidDelegate.cs
│ └── WebApplicationTests.cs
├── Threading
│ ├── HttpContextStorageTests.cs
│ └── HybridContextStorageTests.cs
├── Util
│ ├── WebDIPerformanceTests.cs
│ └── WebUtilsTests.cs
├── Web
│ ├── Services
│ │ └── WebServiceExporterTests.cs
│ ├── Support
│ │ ├── AbstractHandlerFactoryTests.cs
│ │ ├── ControlInterceptionTests.cs
│ │ ├── ControlInterceptionTests.objects.xml
│ │ ├── HandlerMapTests.cs
│ │ ├── LocalResourceManagerTests.cs
│ │ ├── MimeMediaTypeTests.cs
│ │ ├── PageHandlerFactoryTests.cs
│ │ ├── ResultFactoryRegistryTests.cs
│ │ └── ResultTests.cs
│ └── UI
│ ├── Controls
│ │ ├── AbstractValidationControlTests.cs
│ │ ├── HeadTests.cs
│ │ ├── ValidationErrorsTests.cs
│ │ └── ValidationSummaryTests.cs
│ ├── PageTests.cs
│ ├── SessionModelPersistenceMediumTests.cs
│ └── UserControlTests.cs
└── WebCompilerOptionsTests.cs
951 directories, 5166 files
标签:
好例子网口号:伸出你的我的手 — 分享!
小贴士
感谢您为本站写下的评论,您的评论对其它用户来说具有重要的参考价值,所以请认真填写。
- 类似“顶”、“沙发”之类没有营养的文字,对勤劳贡献的楼主来说是令人沮丧的反馈信息。
- 相信您也不想看到一排文字/表情墙,所以请不要反馈意义不大的重复字符,也请尽量不要纯表情的回复。
- 提问之前请再仔细看一遍楼主的说明,或许是您遗漏了。
- 请勿到处挖坑绊人、招贴广告。既占空间让人厌烦,又没人会搭理,于人于己都无利。
关于好例子网
本站旨在为广大IT学习爱好者提供一个非营利性互相学习交流分享平台。本站所有资源都可以被免费获取学习研究。本站资源来自网友分享,对搜索内容的合法性不具有预见性、识别性、控制性,仅供学习研究,请务必在下载后24小时内给予删除,不得用于其他任何用途,否则后果自负。基于互联网的特殊性,平台无法对用户传输的作品、信息、内容的权属或合法性、安全性、合规性、真实性、科学性、完整权、有效性等进行实质审查;无论平台是否已进行审查,用户均应自行承担因其传输的作品、信息、内容而可能或已经产生的侵权或权属纠纷等法律责任。本站所有资源不代表本站的观点或立场,基于网友分享,根据中国法律《信息网络传播权保护条例》第二十二与二十三条之规定,若资源存在侵权或相关问题请联系本站客服人员,点此联系我们。关于更多版权及免责申明参见 版权及免责申明


网友评论
我要评论